DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and HERC3

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens


Alignment Length:306 Identity:79/306 - (25%)
Similarity:127/306 - (41%) Gaps:60/306 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  2841 FKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQREY 2905
            |..:|.....|:.:|.::||.|.|..|:.|::.:.  ||.||..::|....:|..|.|.      
Human   788 FHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKP--GLEDLKELSPTEGRSLQELLDY------ 844

  Fly  2906 ILSDPNID-----------AMEKTEKIEQLDLDGCPIADLGLDFVLPGHANIELCRGGRDTPVTV 2959
                |..|           ..|....|||..|             :||..|:.:|:..|...|..
Human   845 ----PGEDVEETFCLNFTICRESYGVIEQKKL-------------IPGGDNVTVCKDNRQEFVDA 892

  Fly  2960 HNLHQYISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLRMFYPEELECVFCGSGSEQQHSRWEI 3024
            :        |.|.|.| .|.:.:.|...||..|...:.|.:|.|.||..:..|:    .:..|| 
Human   893 Y--------VNYVFQI-SVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGN----SNYNWE- 943

  Fly  3025 KMLQESCRTDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPRLPTGGFKALTPPLTIVRK 3089
             .|:|:......:......::..:|....:..::::.||.|:|||.|:|..|..:|.   .:::.
Human   944 -ELEETAIYKGDYSATHPTVKLFWETFHEFPLEKKKKFLLFLTGSDRIPIYGMASLQ---IVIQS 1004

  Fly  3090 TLDENQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAAN--EG 3133
            |    .:..:|||...||.|.|.||.|||:|::..:|..|.:  ||
Human  1005 T----ASGEEYLPVAHTCYNLLDLPKYSSKEILSARLTQALDNYEG 1046

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058 79/306 (26%)
HERC3NP_055421.1 RCC1 1 1..51
ATS1 2..331 CDD:227511
RCC1 2 52..101
RCC1 3 102..154
RCC1 4 156..207
RCC1 5 208..259
RCC1 6 261..311
RCC1 313..377 CDD:366085
RCC1 7 313..366
HECTc 702..1048 CDD:238033 79/306 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.