DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and HUL5

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:NP_011374.1 Gene:HUL5 / 852736 SGDID:S000003109 Length:910 Species:Saccharomyces cerevisiae


Alignment Length:597 Identity:135/597 - (22%)
Similarity:227/597 - (38%) Gaps:144/597 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  2561 HLLFYATSFDRDRALQRLLDTTPDLNAAESSERVAPRLDRRK-----RAISRTEILKQAEHILQD 2620
            :|.||       ..||...|...:....||.|.:...:|..|     :::...::.|:.:..|: 
Yeast   441 NLRFY-------EELQEYEDLYREHLEEESDEDMEKEIDLDKERPPLKSLLLNKMKKRLKSSLR- 497

  Fly  2621 FGHSKALLE----IQYENEVGTGLGPTLEFYALVSAELQRTDLGLWNGSDSYKQNSVTIVDVVKA 2681
            |...:.|||    |.:|..|..       ||..::.:.:|                         
Yeast   498 FRKLEILLELPFFIPFEERVDL-------FYMFIALDKKR------------------------- 530

  Fly  2682 NSAVLHIEDALEATTTDQNTPAVAGASLVSSSTTTTTTTAQQHQHPPTRSSSRSHVLRSGAGQQP 2746
                |.::|       |.|        |::..|...:|..::.    :...||.:||      :.
Yeast   531 ----LSLDD-------DHN--------LINMFTPWASTGMRKQ----SAIISRDNVL------ED 566

  Fly  2747 VEHSSSSAGANENA-LNMVIAQQFSDTNSANPAAIDNPSSTTTATTVVQHNTTTNNSSIITTTTT 2810
            ..::.:|.|....| |::....:|.:     .|.||....|               ...:||.:.
Yeast   567 AFNAFNSIGERFKASLDVTFINEFGE-----EAGIDGGGIT---------------KEFLTTVSD 611

  Fly  2811 TSYVHAVHGLFPLPLGKSSKLPQMTKAKAKFK---FLGKFMAKAVMDSRMLDLPFSLPFYRWLVS 2872
            ..:....|.||... .:....|.:.....|.|   ||||.:.|.:.:..::|:.|:..|.:.|::
Yeast   612 EGFKDPKHELFRTN-DRYELYPSVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLN 675

  Fly  2873 EEHSI--GLADLMRVAPEVQNTLVRLQDLVRQREYILSDPNIDAMEKTEKIEQLDLDGCPIADLG 2935
            ..:..  ..:||......:.|.|::|.::.                 |::|:.|||      ...
Yeast   676 YSNGFLSSFSDLGSYDSVLYNNLIKLLNMT-----------------TDEIKSLDL------TFE 717

  Fly  2936 LDFVLPGHANIELCRGGRDTPVTVHNLHQYISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLRM 3000
            :|........::|...|..|.||..|:..|::.||.:.|.:...|...|...|...:.....:.|
Yeast   718 IDEPESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEM 782

  Fly  3001 FYPEELECVFCGSGSEQQHSRWEIKMLQESCRTDH-GFHQDSQAIQYLYEILASYNRDEQRAFLQ 3064
            |...||:.:..|       .|..|.:......|:: |:.::.|.|...:|:|..:..:|:..||:
Yeast   783 FNSIELQMLISG-------ERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVLNEFKFEEKLNFLK 840

  Fly  3065 FVTGSPRLPTGGFKALTPPLTIVRKTLDENQNPNDY-LPSVMTCVNYLKLPDYSSREVMRQKLKV 3128
            |||..|:.|..|||||.|...|      .|.....| ||:..||||.||||||.::.::|:||..
Yeast   841 FVTSVPQAPLQGFKALDPKFGI------RNAGTEKYRLPTASTCVNLLKLPDYRNKTILREKLLY 899

  Fly  3129 AANEGSMSFHLS 3140
            |.|.|: .|.||
Yeast   900 AINSGA-RFDLS 910

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058 87/326 (27%)
HUL5NP_011374.1 HUL4 35..910 CDD:227354 133/595 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.