DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and Smurf1

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:XP_006504947.1 Gene:Smurf1 / 75788 MGIID:1923038 Length:757 Species:Mus musculus


Alignment Length:303 Identity:86/303 - (28%)
Similarity:137/303 - (45%) Gaps:52/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  2841 FKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQREY 2905
            |.|:|:.|..||.....::..|::|||:.|:.:  .|.|:||..|.||:..:||.:         
Mouse   489 FHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGK--PIQLSDLESVDPELHKSLVWI--------- 542

  Fly  2906 ILSDPNIDAMEKTEKIEQLDLDGCPIADLGLDFVLPGHA-----NIELCRGGRDTPVTVHNLHQY 2965
                              |:.|..|:.|  ..|.:..:|     ..||...||:.|||..|..:|
Mouse   543 ------------------LENDITPVLD--HTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEY 587

  Fly  2966 ISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLRMFYPEELECVFCGSGSEQQHSRWEIKMLQES 3030
            :.|...|..:.|::.||.||::||:.:.|...|:.|..:|||.:. |...:...:.|:.....:.
Mouse   588 VRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELII-GGLDKIDLNDWKSNTRLKH 651

  Fly  3031 CRTDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPRLPTGGFKAL------TPPLTIVRK 3089
            |..      ||..:::.::.:.:::.:.:...|||||||.|:|..|||||      ..|......
Mouse   652 CVA------DSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIH 710

  Fly  3090 TLDENQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAANE 3132
            .:|.|   .|.||...||.|.:.:|.|.|.|.:.:||..|..|
Mouse   711 LIDAN---TDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEE 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058 86/303 (28%)
Smurf1XP_006504947.1 C2_Smurf-like 14..138 CDD:176028
WW 236..267 CDD:197736
WW 307..339 CDD:197736
HECTc 399..754 CDD:238033 86/303 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.