DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and hectd2

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:XP_009304826.1 Gene:hectd2 / 562999 ZFINID:ZDB-GENE-100405-3 Length:756 Species:Danio rerio


Alignment Length:343 Identity:88/343 - (25%)
Similarity:153/343 - (44%) Gaps:68/343 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  2815 HAVHGLFPLPLGKSSKLPQMTKAK----AKFKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSE-- 2873
            |..:|:|...  |.|:....:..|    ::|:.:|..|..||.:|..||:.|....|:.|::.  
Zfish   454 HTDYGMFTYV--KESQCYWFSSWKCDNYSEFRLVGALMGLAVYNSITLDIRFPPCVYKKLLTPPI 516

  Fly  2874 -----EHSIGLA-----DLMRVAPEVQNTLVRLQDLVRQREYILSDPNIDA-MEKTEKIEQLDLD 2927
                 :..:|:|     ||.::.|::.:.|         .|.:..:.|::. ...|.::.|.:|.
Zfish   517 VPCDLDTPVGMATLTLDDLQQIMPDLAHGL---------GELLSYEGNVEEDFYTTFQVFQEELG 572

  Fly  2928 GCPIADLGLDFVLPGHANIELCRGGRDTPVTVHNLHQYISLVTYWFLIEGVQKQFEALREGFDSV 2992
                       |:..:   .|..||...|||..|..:|:.|...:.|.:.:.:||.|...||.||
Zfish   573 -----------VVKAY---NLKPGGDKIPVTNLNRKEYVQLYIDFLLNKSIYRQFAAFYHGFHSV 623

  Fly  2993 FPIQRLRMFYPEELECVFCGS-----GSEQQHSRWEIKMLQESCRTDHGFHQDSQAIQYLYEILA 3052
            .....|.:..|||:|.:.|||     ||.|:..::|            |:.:....|:..::::.
Zfish   624 CASNALMLLRPEEVEILVCGSPNLDMGSLQRVVQYE------------GYSKTDPTIRAFWDVVL 676

  Fly  3053 SYNRDEQRAFLQFVTGSPRLPTGGFKALTPPLTIVRKTLDENQNPNDYLPSVMTCVNYLKLPDYS 3117
            ::..:.|:..|.|.|||.|:|.||...|...::.:..:       .|:||...||.|.:.||.|.
Zfish   677 AFPLELQKKLLHFTTGSDRVPVGGMADLNFKISKIDVS-------TDWLPVSHTCFNQICLPPYK 734

  Fly  3118 SREVMRQKLKVAAN--EG 3133
            |::.:||||.:|.:  ||
Zfish   735 SKKELRQKLTIAISNAEG 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058 87/340 (26%)
hectd2XP_009304826.1 HECTc 397..754 CDD:238033 88/343 (26%)
HECTc 420..753 CDD:214523 88/343 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.