DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and Magix

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:NP_061302.2 Gene:Magix / 54634 MGIID:1859644 Length:324 Species:Mus musculus


Alignment Length:287 Identity:59/287 - (20%)
Similarity:99/287 - (34%) Gaps:98/287 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  2000 SGAGLAYTVSQHGA------GSGAGGLNAAAVAASISKSISHANLLAAANRERARQWVREQAVDF 2058
            :.|.|...|.:.||      ..|..||::|.:..:.|: :.||.|:        :...:.|..:.
Mouse    44 AAADLTALVRKAGATLRLRHTEGVSGLDSADIEVTDSR-LPHATLV--------KHRPQHQRSET 99

  Fly  2059 VKRYTE----QEAKRSKAASESGAT-------QSGSSGVGL------SSTGNTPL---------- 2096
            :..:||    .:.|.|.|.....||       ..|.:|.||      :.:|:.||          
Mouse   100 LGTWTEPLPVTQNKASYALKVPQATGRFSVELTRGPAGFGLTLSGGRNVSGDAPLTVHGLLKDGP 164

  Fly  2097 -------------------STAGSTN--VLERLSSILFKLNGSYHDCLDALLELKTILLESDISP 2140
                               ||.|.|:  |:||:.:      |..|.||         :|:   .|
Mouse   165 AQRCGRLQAGDLVLYINGQSTQGLTHAQVVERIRT------GGPHLCL---------VLQ---RP 211

  Fly  2141 FEVNHSGLIKAMLNYMTSETGLVERDARLRSFMHVFAGLPLEPL----LQNVGQMPTIEPIAFGA 2201
            .:::.| .||.:..:..::..|..|.:|:.|      ...:.|:    .......|:.|.:|.|.
Mouse   212 QDMDGS-RIKEVGGHRKTDRSLDPRGSRVES------RSTISPVHHRPKTRTSPRPSPEAVAIGH 269

  Fly  2202 FVAKLNGCVTQLEQFPVKVHDFPAGPG 2228
            .|..:......||      :..|..||
Mouse   270 VVRAVEHPTEDLE------NRIPGTPG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442 19/83 (23%)
HECTc <2818..3138 CDD:294058
MagixNP_061302.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PDZ 126..211 CDD:214570 19/102 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..263 9/53 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.