DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and Herc6

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:XP_008761185.1 Gene:Herc6 / 362376 RGDID:1561739 Length:1027 Species:Rattus norvegicus


Alignment Length:301 Identity:70/301 - (23%)
Similarity:122/301 - (40%) Gaps:54/301 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  2838 KAKFKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQ 2902
            |:::...|.....::.:..:::|.|.|..|:.|:.::.|                |..|:||   
  Rat   765 KSRYFLFGILCGLSLNNLNVINLSFPLALYKKLLEQKPS----------------LEDLKDL--- 810

  Fly  2903 REYILSDPNIDAMEKTEKIEQLDLDGCPIADLGLDF-VLPGHANIELCRGGRDTPVTVHNLHQYI 2966
              .:|...|:.        |.|:.:...|.:|.:.| :.....:::|...|...||...|...|:
  Rat   811 --SLLLGRNLQ--------EVLNCEAGVIEELHMYFSIYWDQRDVDLIPDGISVPVNETNKRDYV 865

  Fly  2967 S-LVTYWFLIEGVQKQFEALREGFDSVFPIQRLRMFYPEELECVFCGSGSEQQHSRWEIKMLQES 3030
            | .|.|.|.| .::..::....||..|.....:|.|.||||.....|:.:    ..|  |..:.:
  Rat   866 SKCVDYIFNI-SIKTIYDEFHRGFYKVCNRDSIRHFQPEELMAAIIGNPT----CDW--KQFENN 923

  Fly  3031 CRTDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPR-----LPTGGFKALTPPLTIVRKT 3090
            .:.::|:.:....|...::.......||::.||.|:||..|     |...|.:...|      :.
  Rat   924 SKYENGYSKSHPTILLFWKAFHELTLDEKKKFLLFLTGCDRLHVKGLQNEGIRFRCP------EV 982

  Fly  3091 LDENQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAAN 3131
            ..|..||..     :||.:.|.||.||:...|::.|:||.|
  Rat   983 FSERDNPRS-----LTCHSILDLPKYSTMRRMKEALQVAIN 1018

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058 70/301 (23%)
Herc6XP_008761185.1 RCC1 39..88 CDD:278826
RCC1 92..141 CDD:278826
RCC1 144..194 CDD:278826
RCC1_2 182..210 CDD:290274
RCC1_2 236..265 CDD:290274
RCC1 252..299 CDD:278826
HECTc 682..1023 CDD:238033 70/301 (23%)
HECTc 706..1023 CDD:214523 70/301 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.