DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and smurf1

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:NP_001001943.1 Gene:smurf1 / 321695 ZFINID:ZDB-GENE-040426-2744 Length:731 Species:Danio rerio


Alignment Length:304 Identity:87/304 - (28%)
Similarity:135/304 - (44%) Gaps:54/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  2841 FKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQREY 2905
            |.|:|:.|..||.....::..|:||||:.|:.:  .|.|.||..|.||:..:||          :
Zfish   463 FHFVGRIMGLAVFHGHYINGGFTLPFYKQLLGK--PIQLCDLETVDPELHKSLV----------W 515

  Fly  2906 ILSDPNIDAMEKTEKIEQLDLDGCPIADLGLDFVLPGH------ANIELCRGGRDTPVTVHNLHQ 2964
            ||.:.....::.|..:|                    |      ...||...|::.|||..|..:
Zfish   516 ILENDITSVLDHTFCVE--------------------HNAFGKFLQHELKPNGKNIPVTEENKKE 560

  Fly  2965 YISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLRMFYPEELECVFCGSGSEQQHSRWEIKMLQE 3029
            |:.|...|..:.|::.||.||::||:.:.|...|:.|..:|||.:..|.|....:. |:.....:
Zfish   561 YVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDNKELELIIGGLGKIDLND-WKANTRLK 624

  Fly  3030 SCRTDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPRLPTGGFKAL------TPPLTIVR 3088
            .|..      ||..:::.::.:.|::.:.:...|||||||.|:|..|||||      ..|.....
Zfish   625 HCVA------DSNIVKWFWQAVESFDEERRGRLLQFVTGSTRVPLQGFKALQGSTGSAGPRLFTI 683

  Fly  3089 KTLDENQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAANE 3132
            ..:|.|   .|.||...||.|.:.:|.|.|.|.:.:||..|..|
Zfish   684 HLIDAN---TDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEE 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058 87/304 (29%)
smurf1NP_001001943.1 C2_Smurf-like 14..138 CDD:176028
WW 234..266 CDD:197736
WW 280..312 CDD:197736
HECTc 373..728 CDD:238033 87/304 (29%)
HECTc 397..728 CDD:214523 87/304 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.