DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and Smurf2

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:NP_001100531.1 Gene:Smurf2 / 303614 RGDID:1310067 Length:748 Species:Rattus norvegicus


Alignment Length:299 Identity:90/299 - (30%)
Similarity:140/299 - (46%) Gaps:47/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  2841 FKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQREY 2905
            |.|:|:.|..||.....:|..|:||||:.|:.:  ||.|.|:..|.|::.|:||          :
  Rat   483 FHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGK--SITLDDMELVDPDLHNSLV----------W 535

  Fly  2906 ILSDPNIDAMEKTEKIEQLDLDGCPIADLGLDFVLPGHANI---ELCRGGRDTPVTVHNLHQYIS 2967
            ||.:.....::.|..:|.                 ..:..|   ||...|:..|||..|..:|:.
  Rat   536 ILENDITGVLDHTFCVEH-----------------NAYGEIIQHELKPNGKSIPVTEENKKEYVR 583

  Fly  2968 LVTYWFLIEGVQKQFEALREGFDSVFPIQRLRMFYPEELECVFCGSGSEQQHSRWEIKMLQESCR 3032
            |...|..:.|::.||.||::||:.|.|...|:.|..:|||.:.||.| :...|.|:.....:.|.
  Rat   584 LYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLG-KIDVSDWKANTRLKHCT 647

  Fly  3033 TDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPRLPTGGFKALT----PPLTIVRKTLDE 3093
                  .||..:::.::.:..::.:.:...|||||||.|:|..|||||.    |.|..:.: :|.
  Rat   648 ------PDSNVVKWFWKAVELFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQ-IDA 705

  Fly  3094 NQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAANE 3132
            ..|   .||...||.|.:.:|.|.|.|.:.:||..|..|
  Rat   706 CTN---NLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEE 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058 90/299 (30%)
Smurf2NP_001100531.1 C2_Smurf-like 13..137 CDD:176028
PRP40 155..>236 CDD:227435
WW 159..188 CDD:395320
WW 252..283 CDD:197736
WW 298..330 CDD:197736
HECTc 393..745 CDD:238033 90/299 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.