DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and Wwp2

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:NP_001099654.1 Gene:Wwp2 / 291999 RGDID:1310091 Length:870 Species:Rattus norvegicus


Alignment Length:324 Identity:95/324 - (29%)
Similarity:155/324 - (47%) Gaps:60/324 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  2826 GKSSKLPQMTKAKA-------KFKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLM 2883
            ||::...|:..|.:       .|:|:|:|:|.|:...:.:|..|:||||:.::::..:  |.||.
  Rat   583 GKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPT--LRDLE 645

  Fly  2884 RVAPEVQNTLVRLQDLVRQREYILSDPNIDAMEKTEKIEQLDLDGCPIADLGLDF-------VLP 2941
            .:.||..|:::                         .|::.:||.|     ||:.       :|.
  Rat   646 SIDPEFYNSII-------------------------WIKENNLDEC-----GLELFFIQDMEILG 680

  Fly  2942 GHANIELCRGGRDTPVTVHNLHQYISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLRMFYPEEL 3006
            .....||..||.:..||..|..:||.|:|.|....||::|.:|..:||:.|.|::.||.|..:||
  Rat   681 KVTTHELKEGGENIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKEL 745

  Fly  3007 ECVFCGSGSEQQHSRWEIKMLQESCRTDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPR 3071
            |.:.||. .|...|.|     |::....| :.:.|:.||:.::::...:.:::...||||||:.|
  Rat   746 ELMLCGM-QEIDMSDW-----QKNAIYRH-YTKSSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCR 803

  Fly  3072 LPTGGFKAL---TPPLTIVRKTLDENQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAANE 3132
            ||.|||..|   ..|    :|...:......:||...||.|.|.||.|.|.|.:::||..|..|
  Rat   804 LPVGGFAELIGSNGP----QKFCIDRVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLYAIEE 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058 95/324 (29%)
Wwp2NP_001099654.1 C2_E3_ubiquitin_ligase 17..142 CDD:175988
WW 302..331 CDD:278809
WW 332..361 CDD:278809
WW 407..435 CDD:278809
WW 447..477 CDD:238122
HECTc 516..868 CDD:238033 95/324 (29%)
HECTc 539..867 CDD:214523 95/324 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.