DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and HERC4

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:686 Identity:135/686 - (19%)
Similarity:241/686 - (35%) Gaps:177/686 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  2518 HPKIMAKANRQLQDPLV-IMTGNLPQ--------WLPQIGMACPFLFP---FETRHLLFYATSFD 2570
            ||:|..:....|:..|: .:|.:||.        .||:    ||.:..   |.|..:.|.....:
Human   499 HPQISQQVAASLEKNLIPKLTSSLPDVEALRFYLTLPE----CPLMSDSNNFTTIAIPFGTALVN 559

  Fly  2571 RDRALQRLLDT-----TPD--LNAAESSERVAPRLDRRKRAISRTEILKQAEHILQDFGHSKALL 2628
            .::|..::|:.     .|.  |...|..:.|...|.:    :.:..|......|...|.|: ||.
Human   560 LEKAPLKVLENWWSVLEPPLFLKIVELFKEVVVHLLK----LYKIGIPPSERRIFNSFLHT-ALK 619

  Fly  2629 EIQYENEVGTGLGPTLEFYALVSAELQ-----RTDLGLWNGSDSY----KQNSVTIVDVVKANSA 2684
            .::..:.|...:|..:::......|:|     |.|...|....:|    ......:.|:......
Human   620 VLEILHRVNEKMGQIIQYDKFYIHEVQELIDIRNDYINWVQQQAYGMDVNHGLTELADIPVTICT 684

  Fly  2685 VLHIEDALEATTTDQNTPAVAGASLVSSSTTTTTTTAQQHQHPPTRSSSRSHVLRSGAGQQPVEH 2749
            ...:.|| :|.||...|.||....:...         |.|:.                       
Human   685 YPFVFDA-QAKTTLLQTDAVLQMQMAID---------QAHRQ----------------------- 716

  Fly  2750 SSSSAGANENALNMVIAQQFSDTNSANPAAIDNPSSTTTATTVVQHNTTTNNSSIITTTTTTSY- 2813
                   |.::|.:.:.:      |.||..|         ..|.:.|...:...::..|....| 
Human   717 -------NVSSLFLPVIE------SVNPCLI---------LVVRRENIVGDAMEVLRKTKNIDYK 759

  Fly  2814 ------------------------------VHAVHGLFPLPLGKSSKL----PQMTKAKAKFKFL 2844
                                          :...:|:|  ...:.|:|    .:..:....|..:
Human   760 KPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMF--RYYEDSRLIWFSDKTFEDSDLFHLI 822

  Fly  2845 GKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQREYILSD 2909
            |.....|:.:..::||.|.|..|:.|:.::.|  |.||..:.|:|..::.:|.|...        
Human   823 GVICGLAIYNCTIVDLHFPLALYKKLLKKKPS--LDDLKELMPDVGRSMQQLLDYPE-------- 877

  Fly  2910 PNIDAMEKTEKIEQLDLDGCPIADLGLDFVLP----GHANI-ELCRGGRDTPVTVHNLHQYISLV 2969
               |.:|:|               ..|:|.:.    |...: ||...|.||.|...|..:::...
Human   878 ---DDIEET---------------FCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAY 924

  Fly  2970 TYWFLIEGVQKQFEALREGFDSVFPIQRLRMFYPEELECVFCGSGSEQQHSRWEIKMLQESCRTD 3034
            ..:...:.|...|:|...||..|...:.|.:|.|.||:.:..|      ::.::.|.|:::....
Human   925 VDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIG------NTNYDWKELEKNTEYK 983

  Fly  3035 HGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPRLPTGGFKALTPPLTIVRKTLDENQNPND 3099
            ..:..:...|:..:|:......::::.||.|:|||.|:|..|.|:|       :..:.......:
Human   984 GEYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSL-------KLVIQSTGGGEE 1041

  Fly  3100 YLPSVMTCVNYLKLPDYSSREVMRQKL--KVAANEG 3133
            |||...||.|.|.||.|:.:|.:|.||  .:..|||
Human  1042 YLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEG 1077

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058 78/327 (24%)
HERC4XP_011537894.1 RCC1 2..368 CDD:332518
HECTc 733..1079 CDD:238033 83/397 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.