DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and etc-1

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:NP_495842.1 Gene:etc-1 / 174388 WormBaseID:WBGene00008429 Length:1001 Species:Caenorhabditis elegans


Alignment Length:404 Identity:93/404 - (23%)
Similarity:177/404 - (43%) Gaps:76/404 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  2755 GANENALNMVIAQQFSDTNSANPAAIDN--------PSSTTTATTVVQHNTTTNNSSIITTTTTT 2811
            |...|.|..::..:..:....|.:.||.        .....||..|.:...|...|.::....|.
 Worm   656 GDKVNDLKSMVRVKMVNWAGMNESGIDGGGIFREFLSELLKTAFNVERGFFTFTESKLLYPNPTA 720

  Fly  2812 SYVHAVHGLFPLPLGKSSKLPQMTKAKAKFKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHS 2876
            .::..|..|                  |.|:|:|:.:.|.:.:.::.::.|:..|...:...:.:
 Worm   721 PFLLGVDCL------------------AHFQFIGRMIGKLIYERQLQEVRFAEFFIAQIFETDKN 767

  Fly  2877 IGLADLMRVAPEVQNTLVRLQDLVRQREYILSDP----NIDAMEK--TEKIEQLDLDGCPI-ADL 2934
            ..:                  ||...:.:   ||    ::.|::|  ..::::|.||...: :|:
 Worm   768 KDV------------------DLQHMKSF---DPIIFKHLKALQKMNNRELDELQLDFSVVTSDM 811

  Fly  2935 GLDFVLPGHANIELCRGGRDTPVTVHNLHQYISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLR 2999
            ||      ..|:.|...|....|||.|:|:|:.|...:.|.:.:....:|:|:|...:..|:.:|
 Worm   812 GL------VRNVNLKPNGSKFRVTVENVHEYVRLYVNYHLKQRIASMVDAVRKGISEIISIEWMR 870

  Fly  3000 MFYPEELECVFCGSGSEQQHSRWEIKMLQESCRTDHGFHQDSQAIQY---LYEILASYNRDEQRA 3061
            ||.|.||:.:..|     ....:..|.|::.|  :..|...:|.|.|   .::::...:.|:::|
 Worm   871 MFAPHELQIMIAG-----YEEVFTAKELRKFC--ELRFAAGTQDINYEEMFWDVIDKLSNDDKKA 928

  Fly  3062 FLQFVTGSPRLPTGGFKALTPPLTIVRKTLDENQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKL 3126
            .|:||||..|.|..|||::.|.:.::     ...:.:|.||:..||:|.|::|.||:|..:.:||
 Worm   929 LLKFVTGCSRAPVDGFKSIQPRMGVL-----VIPSSDDELPTSATCMNMLRIPKYSNRTKLEEKL 988

  Fly  3127 KVAANEGSMSFHLS 3140
            :.|.|.|: .|.|:
 Worm   989 RYAINSGA-GFELA 1001

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058 78/329 (24%)
etc-1NP_495842.1 HECTc 661..998 CDD:214523 89/394 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.