DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ctrip and herc3

DIOPT Version :9

Sequence 1:NP_001189170.1 Gene:ctrip / 40596 FlyBaseID:FBgn0260794 Length:3140 Species:Drosophila melanogaster
Sequence 2:NP_001139096.1 Gene:herc3 / 100003587 ZFINID:ZDB-GENE-090313-139 Length:1046 Species:Danio rerio


Alignment Length:297 Identity:72/297 - (24%)
Similarity:128/297 - (43%) Gaps:47/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  2841 FKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQREY 2905
            |..:|.....|:.:|.::||.|.|..|:.|:  |.|..|.||..::|....:|.:|         
Zfish   785 FHLIGIICGLAIYNSTVVDLHFPLVLYKKLL--EISPTLDDLKELSPTEGRSLQQL--------- 838

  Fly  2906 ILSDPNIDAMEKTEKIEQLDLDGCPIADLGLDFVLP----GHANI-ELCRGGRDTPVTVHNLHQY 2965
                              |:.:|.......|:|.:.    |...: ||.:||:...|...|..::
Zfish   839 ------------------LEFEGDVEETFCLNFAITREYYGITEVKELVQGGKTIAVDKTNRKEF 885

  Fly  2966 ISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLRMFYPEELECVFCGSGSEQQHSRWEIKMLQES 3030
            :.....:...:.||:|:.|...||..|...:.|.:|.|.||..:..|:    .:..||  .::::
Zfish   886 VQAYLQYVFSDAVQEQYSAFSSGFLKVCGGEILSLFQPSELMAMVVGN----NNYNWE--EMEKN 944

  Fly  3031 CRTDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPRLPTGGFKALTPPLTIVRKTLDENQ 3095
            ......|......::..:|:...::.::::.||.|:|||.|:|..|..:|.   .:::.|..|..
Zfish   945 ASYKGEFSATHPTVKMFWEVFHEFSLEKKKQFLLFLTGSDRIPIHGMASLR---IVIQSTAAEEH 1006

  Fly  3096 NPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAANE 3132
                |||...||.|.|.:|.|.::|.:||:|..|..:
Zfish  1007 ----YLPVAHTCYNMLDMPCYQTKETLRQRLTQAVEQ 1039

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctripNP_001189170.1 Extensin_2 <688..731 CDD:252669
WWE 1409..1481 CDD:128922
FAM199X <1985..2074 CDD:292442
HECTc <2818..3138 CDD:294058 72/297 (24%)
herc3NP_001139096.1 RCC1 4..49 CDD:278826
RCC1_2 37..65 CDD:290274
RCC1 52..99 CDD:278826
RCC1 103..152 CDD:278826
RCC1 155..205 CDD:278826
RCC1 208..257 CDD:278826
RCC1 260..308 CDD:278826
RCC1 314..374 CDD:278826
HECTc 699..1044 CDD:238033 72/297 (24%)
HECTc 723..1043 CDD:214523 72/297 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.