DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and YPR015C

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_015340.1 Gene:YPR015C / 856125 SGDID:S000006219 Length:247 Species:Saccharomyces cerevisiae


Alignment Length:283 Identity:63/283 - (22%)
Similarity:99/283 - (34%) Gaps:90/283 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PYKCH---------LCSKTFRMKGSLRIHLKVVHMMGVPCSN-------PNPNPNPSPTPASTTS 204
            |.||.         ..||.........:||.       |||:       |..|....|.||...:
Yeast    14 PMKCSSSNIGGSYAQSSKEVSNTTKREVHLP-------PCSSIMHAPLTPEINQAALPPPAYHYA 71

  Fly   205 AVTATPKLSICDRIRHTEPGALGNGNNS-----TCTASQPYALSGALSMLQQSPSSPESGTATPK 264
            .          ..:..||.....:..||     .....||:    .|:.:::....|...||   
Yeast    72 P----------SSLHQTEDPVWRSSPNSIIFSPVIATPQPF----PLTFVERQSCCPIYSTA--- 119

  Fly   265 LWECDVCSKSFTT-------KYFLKKHKR-----------LHTGEMPYTCEICARTFTFQQSYHK 311
                   :.|:|.       ::|.:::.|           :|.|:.|.|  :.::|.|......|
Yeast   120 -------ASSYTAQSVPPSMQHFQEENHRAVSNEQYSLPNVHIGQNPGT--LLSQTQTDLDLIQK 175

  Fly   312 HLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKC--EVCGKCFRQRVSFLVHTRIHTG 374
            .|....:::.. |.:||:.....|||..|..||:|:.||||  |.|.|.|..:.:.|.|.|.|  
Yeast   176 QLRAVVKLRKQ-CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH-- 237

  Fly   375 VMPYKCELCQKTFRYKVSQRTHR 397
                     ||    |::::.|:
Yeast   238 ---------QK----KIAKKKHQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 4/37 (11%)
zf-H2C2_2 281..304 CDD:290200 6/33 (18%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
zf-H2C2_2 339..361 CDD:290200 12/23 (52%)
C2H2 Zn finger 352..372 CDD:275368 8/21 (38%)
zf-H2C2_2 364..389 CDD:290200 6/24 (25%)
C2H2 Zn finger 380..396 CDD:275368 3/15 (20%)
YPR015CNP_015340.1 COG5048 <17..247 CDD:227381 60/278 (22%)
C2H2 Zn finger 187..207 CDD:275370 7/19 (37%)
C2H2 Zn finger 215..237 CDD:275370 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.