DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and AZF1

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_014756.3 Gene:AZF1 / 854280 SGDID:S000005639 Length:914 Species:Saccharomyces cerevisiae


Alignment Length:371 Identity:84/371 - (22%)
Similarity:135/371 - (36%) Gaps:104/371 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ELRDMHVRL-VHENAE-------GEPKQK-------EPQQKEPDQEPYKCHLCSKTFRMKGSLRI 174
            :|:::..|| .|.|.|       ..|..|       |...|..|:...:.::..|  |.|....:
Yeast   416 DLKEIEQRLRKHLNDEDNYSSAISRPLDKNDVIEGSEGLNKHIDESGMQPNIIKK--RKKDDSTV 478

  Fly   175 HLK-VVHMMGVPCSNPN-----------------PNPNPSPTPASTTSAVTATP----------- 210
            ::| .:.....|.|..|                 |.|:.|......|:.:.||.           
Yeast   479 YVKNEMPRTDPPMSKDNSTSAEGAAMANFSGKEPPIPDISSVSDDATNLIGATKVDQLMLIIQAR 543

  Fly   211 KLSICDRIRHTEPGALGNGNNSTCTASQPYA-LSGALSMLQQSPSSPESGTATPKLWECDVCSKS 274
            |....:::..|:.|.|  ..|.|.....|.: |.|.:    :.|...:: |...|..||..|.:.
Yeast   544 KKGFTEKVNTTQDGDL--LFNQTMDILPPKSELVGGV----EKPKGTQN-TRAVKKHECPYCHRL 601

  Fly   275 FTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHN 339
            |:....|:.|.|.|.|                            .||.||..||:.|.:...|..
Yeast   602 FSQATHLEVHVRSHIG----------------------------YKPFVCDYCGKRFTQGGNLRT 638

  Fly   340 HQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCEL--CQKTFRYKVSQRTHRCPTEE 402
            |:|:|:||||:.|::|.|.|.::.:...|...|..:.|:.|:|  |.|||....:.:.|:     
Yeast   639 HERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQ----- 698

  Fly   403 AQTPEQLIKAFLEGNDSHTQPSPA-SAEIAAINSSSIVDPEQEALL 447
                          |..|.:...| :|::|.:|.|..:..|:..||
Yeast   699 --------------NRFHKETLNALTAKLAEMNPSENIPLEERQLL 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
zf-H2C2_2 281..304 CDD:290200 5/22 (23%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
zf-H2C2_2 339..361 CDD:290200 11/21 (52%)
C2H2 Zn finger 352..372 CDD:275368 5/19 (26%)
zf-H2C2_2 364..389 CDD:290200 9/26 (35%)
C2H2 Zn finger 380..396 CDD:275368 6/17 (35%)
AZF1NP_014756.3 COG5048 342..768 CDD:227381 84/371 (23%)
C2H2 Zn finger 595..615 CDD:275368 6/19 (32%)
C2H2 Zn finger 623..643 CDD:275368 7/19 (37%)
C2H2 Zn finger 651..671 CDD:275368 5/19 (26%)
C2H2 Zn finger 679..702 CDD:275368 8/41 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.