DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and STP4

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_010235.1 Gene:STP4 / 851512 SGDID:S000002206 Length:490 Species:Saccharomyces cerevisiae


Alignment Length:332 Identity:69/332 - (20%)
Similarity:106/332 - (31%) Gaps:89/332 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TIH--------LFSHTSLMAQEGNESPANGQP------------ASSRGFLAAAPPKRRAKRTRS 96
            |||        |.|.|:..::....|..|..|            :|:...:.::|....|....|
Yeast    45 TIHHLIDPSLPLLSSTTSSSRSTLSSTLNSPPPPPLTTSYSSYNSSACQSITSSPTDNTALAHNS 109

  Fly    97 KPVVP---TPPPVRTTPPAHCDICEF-SFRNTELRDMHVRLVHENAEGEPKQKEPQQKEP----- 152
            |...|   :|.|:.:...:|..:... ||.|.      :.:......|...........|     
Yeast   110 KCYFPHSLSPTPLSSNSSSHVILPPISSFTNL------ITVAEREFNGRSNSLHANFTSPVPRTV 168

  Fly   153 -DQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVTATPKLSICD 216
             |...::...|                             |||      :||...|.||.    .
Yeast   169 LDHHRHELTFC-----------------------------NPN------NTTGFKTITPS----P 194

  Fly   217 RIRHTE--PGALGNGNNSTCTASQPYALSGALSML-----QQSPSSPESGTATPKLWECDVCSKS 274
            ..:|..  |.|:.|...|...:|.|  :||...::     ||..:|..|.:|.|.:.  ...:..
Yeast   195 PTQHQSILPTAVDNVPRSKSVSSLP--VSGFPPLIVKQQQQQQLNSSSSASALPSIH--SPLTNE 255

  Fly   275 FTTKY--FLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTL 337
            .|::|  .||...::........|.|| ..|....|.||......|.:||.|.:|.|.|...:.|
Yeast   256 HTSRYSSSLKDSAKITKQRKKKECPIC-HNFYANLSTHKSTHLTPEDRPHKCPICQRGFARNNDL 319

  Fly   338 HNHQRIH 344
            ..|::.|
Yeast   320 IRHKKRH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 4/21 (19%)
zf-H2C2_2 281..304 CDD:290200 5/22 (23%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 339..361 CDD:290200 2/6 (33%)
C2H2 Zn finger 352..372 CDD:275368
zf-H2C2_2 364..389 CDD:290200
C2H2 Zn finger 380..396 CDD:275368
STP4NP_010235.1 COG5048 14..442 CDD:227381 69/332 (21%)
C2H2 Zn finger 279..296 CDD:275368 7/17 (41%)
C2H2 Zn finger 306..326 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.