DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and STP3

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_013479.3 Gene:STP3 / 851089 SGDID:S000004367 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:396 Identity:85/396 - (21%)
Similarity:122/396 - (30%) Gaps:122/396 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VPSFGSIDALQQRLIKAA----NGPLA-------CPFANCK----ELFLGLDKLTIHLFSHTSLM 62
            :|...|.|    .|||||    ||..:       .|..|..    ........|:..|..|::.:
Yeast    14 LPPISSFD----NLIKAAERQYNGEASSASTHPTLPNMNISNGSGSAGASSSMLSYQLLPHSNDV 74

  Fly    63 AQEGNES---PANGQPASSRGFLAAAPPKRRAKRTRS-KPV-------------VPTPPPVRTTP 110
            ::..:.|   |:..||  :.|..:|:.....|..:|| .|:             |.||...:...
Yeast    75 SRSNSSSSFLPSVQQP--TEGSASASETSSSASPSRSISPILKVAGPSSVGGAGVSTPHSTKINK 137

  Fly   111 P---AHCDICEFSFRNTELRDMHVRLVHENAEGEPKQKEPQQKEPDQEPYKCHLCSKTFRMKGSL 172
            |   ..|.||         |:.:..|....|         ....|:..|:||.:|.:.|.....|
Yeast   138 PRKKKQCPIC---------RNFYANLTTHKA---------THLTPEDRPHKCPICHRGFARNNDL 184

  Fly   173 RIHLK------VVHMMGVPCSNPNPNPNPSPTPASTTSAVTATPKLSICD----RIRHTEPGALG 227
            ..|.|      ::...|| .||.|.....|.:|....:....||..|:.|    :..|...|...
Yeast   185 LRHKKRHWKDEILSQSGV-LSNHNDGKGGSVSPNDDDTHEKMTPMNSVTDYAQLKSLHQIKGTFK 248

  Fly   228 NGNNSTCTA----SQPYALSGALSMLQQSPSSPESGTATPKLWECDVCSKS--FTTKYFLKKH-K 285
            ...|||...    ..||.|.                   |..:|...|.::  |:.....|.| |
Yeast   249 CPFNSTLIQLDMDMYPYKLK-------------------PLNFETSNCHQTGVFSRCDTFKNHLK 294

  Fly   286 RLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPF 350
            .||              |.:.....|.   ...|.|..|..||..|:.:....|.   |.|::  
Yeast   295 ALH--------------FEYPPGTKKK---DRNVVPGRCKHCGLKFENVDVWLNE---HVGKQ-- 337

  Fly   351 KCEVCG 356
                ||
Yeast   338 ----CG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 5/22 (23%)
zf-H2C2_2 281..304 CDD:290200 5/23 (22%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
zf-H2C2_2 339..361 CDD:290200 5/18 (28%)
C2H2 Zn finger 352..372 CDD:275368 2/5 (40%)
zf-H2C2_2 364..389 CDD:290200
C2H2 Zn finger 380..396 CDD:275368
STP3NP_013479.3 COG5048 <137..295 CDD:227381 41/195 (21%)
C2H2 Zn finger 144..161 CDD:275368 6/34 (18%)
C2H2 Zn finger 171..191 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.