DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and AT3G29340

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 / 822592 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana


Alignment Length:572 Identity:117/572 - (20%)
Similarity:176/572 - (30%) Gaps:223/572 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 KRTRSKPVVPTPPPVRTTPPAHCDICEFSFRNTELRDMHVRLVHENAEGEPKQ--------KEPQ 148
            |.|....|:.....:::.....|.||..||...:....|.|:.....|...||        |...
plant    23 KSTTCSGVIALRSNLQSKSSHKCKICGKSFECYQALGGHQRIHRPIKEKLSKQEFSEVYPRKSKL 87

  Fly   149 QKEPDQEP--YKCHLCSKTF----RMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVT 207
            ||.|:...  |:|.:|.|.|    .:.|..::|......:   .|..:.|   |...:|....:.
plant    88 QKRPESSSSCYECKVCGKIFGCYRGLGGHTKLHRSTKREL---ASTQDEN---SLLDSSEAKKIV 146

  Fly   208 ATP---KLSICDRIRHTEPGALGNGNNSTCTA-----SQPYALSGALSMLQQSPSSPESGTATPK 264
            :.|   |:|..::..|             |..     |:|.:.||||      ||:..|...|..
plant   147 SQPSSFKVSQEEKFLH-------------CVELKQDFSEPLSHSGAL------PSTLRSKLQTKT 192

  Fly   265 LWE----CDVCSKSFTTKYFLKKHKRLH---TGEMPYTCEICARTFT------------------ 304
            .|:    |.:|.|||.....|..|||:|   :|::     .|.|.:|                  
plant   193 QWKSSCHCKICGKSFVCSQGLGNHKRVHREISGKL-----ACKRKYTEDYNPFSDSLKAKKIVKK 252

  Fly   305 ---FQQSYHKHLLYHSEVKP--------------------------------------------- 321
               |:.|..:.:|:..|:|.                                             
plant   253 PSSFEVSQEEKILHCVELKQDFGELLAHSGFDKSISCSKSIKVKKVARKNEKTEDSTSLFGVFVG 317

  Fly   322 ------HVCGVCGRAFKELSTLHNHQRIHSG-----------EKPF----KCEVCGKCFRQRV-- 363
                  |.|..|||.|..|..::.|||:|||           |:.:    |..||......|.  
plant   318 EMSQRLHGCKTCGRKFGTLKGVYGHQRMHSGNHNRIEDENGLERIWGLKKKSRVCSVSAFDRFKG 382

  Fly   364 -SFLVHTRIH-------------TGV--------MP--------------------------YKC 380
             ||:.....|             .||        :|                          |||
plant   383 SSFMAEIEKHEVIEAALNLVMLCQGVYDFASISNLPLGDGFMDLELKPCPLRRKLQKKSRSSYKC 447

  Fly   381 ELCQKTFRYKVS----QRTHRCPTEEAQTPEQLIKAFLEGNDSHTQPSPASAEIAAINSS----- 436
            .:|:|:|....:    ||.||  .:....||     ::| :||....|..:.:|.:..||     
plant   448 SICEKSFVCSQALGSHQRLHR--WKLVPKPE-----YIE-DDSSLLDSSEAKKIVSKPSSFEHAQ 504

  Fly   437 -----SIVDPE---QEALLSQSIDDIVVEQCQKLGICGVEPREEGQLISLQP 480
                 ..|:|:   .|.|.....|..  :.|.|:....:....|.:.|..||
plant   505 EEKILQCVEPKLEFHEQLAHSGFDKF--DTCSKIRFSALPSPPEAKKIVSQP 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
zf-H2C2_2 281..304 CDD:290200 8/25 (32%)
C2H2 Zn finger 324..344 CDD:275368 9/19 (47%)
zf-H2C2_2 339..361 CDD:290200 10/36 (28%)
C2H2 Zn finger 352..372 CDD:275368 5/22 (23%)
zf-H2C2_2 364..389 CDD:290200 12/71 (17%)
C2H2 Zn finger 380..396 CDD:275368 6/19 (32%)
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623 7/24 (29%)
C2H2 Zn finger 45..65 CDD:275368 7/19 (37%)
C2H2 Zn finger 100..120 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2696
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.