Sequence 1: | NP_649494.1 | Gene: | CG14655 / 40594 | FlyBaseID: | FBgn0037275 | Length: | 525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_780324.2 | Gene: | Ikzf5 / 67143 | MGIID: | 1914393 | Length: | 419 | Species: | Mus musculus |
Alignment Length: | 311 | Identity: | 70/311 - (22%) |
---|---|---|---|
Similarity: | 99/311 - (31%) | Gaps: | 104/311 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 267 ECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAF 331
Fly 332 KELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCE------------LCQ 384
Fly 385 KTFRYKVSQR---------------------THRCPTEEAQTPEQLIK----------------- 411
Fly 412 ------AFLEGNDSHTQP---SPASAEIAAINSSS---IVDPEQEALLSQSIDDIVVEQCQKLGI 464
Fly 465 CGVEPREEGQLISLQPVA------VVHFS----GNGSPLQQLQNLRIYSPQ 505 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14655 | NP_649494.1 | C2H2 Zn finger | 268..288 | CDD:275368 | 5/19 (26%) |
zf-H2C2_2 | 281..304 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 324..344 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 339..361 | CDD:290200 | 11/21 (52%) | ||
C2H2 Zn finger | 352..372 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 364..389 | CDD:290200 | 7/36 (19%) | ||
C2H2 Zn finger | 380..396 | CDD:275368 | 5/48 (10%) | ||
Ikzf5 | NP_780324.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 36..55 | ||
C2H2 Zn finger | 84..104 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 96..121 | CDD:404364 | 11/28 (39%) | ||
C2H2 Zn finger | 112..132 | CDD:275368 | 8/47 (17%) | ||
zf-H2C2_2 | 124..148 | CDD:404364 | 13/47 (28%) | ||
C2H2 Zn finger | 140..158 | CDD:275368 | 5/17 (29%) | ||
fibronec_FbpA | <216..>352 | CDD:411474 | 30/139 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 262..284 | 6/21 (29%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 297..356 | 14/62 (23%) | |||
C2H2 Zn finger | 366..393 | CDD:275371 | |||
C2H2 Zn finger | 394..416 | CDD:275371 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |