DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and ZNF667

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001308285.1 Gene:ZNF667 / 63934 HGNCID:28854 Length:610 Species:Homo sapiens


Alignment Length:403 Identity:108/403 - (26%)
Similarity:166/403 - (41%) Gaps:85/403 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LQQRLIKAANGPLACPFANCKELFLGLDKLTIHLFSHTSLMAQEGNESPANGQPASSRGFLAAAP 86
            :.|::....|   .|....|.:.|..:..|.:|...|......:.|:        ..|||     
Human   242 IHQKIHVVGN---VCQCRKCGKAFNQMSSLLLHKKIHNGKKTHKYNK--------CGRGF----- 290

  Fly    87 PKRRA-----KRTRSKPVVPTPPPVRTTP----------PAHCDICEFSFRNTELRDMHVRLVHE 136
             |:::     ||..:...:|......:..          |..|..|...|.......:|.| :|.
Human   291 -KKKSVFVVHKRIHAGEKIPENAKALSQSLQQRSHHLENPFKCRKCGKLFNRISPLMLHQR-IHT 353

  Fly   137 NAEGEPKQKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGV-PCSNPNPNPNPSPTPA 200
            :                ::||||..|.|.||...:|.:||::.:...: .|:......|...:..
Human   354 S----------------EKPYKCDKCDKFFRRLSTLILHLRIHNGEKLYRCNKCEKVCNRHSSLI 402

  Fly   201 STTSAVTATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPESGTATPKL 265
            ......|...||..|     .|.|.:.:|.              |...:.|:..|.|      |.
Human   403 QHQKVHTKKKKLFEC-----KECGKMFSGT--------------ANLKIHQNIHSEE------KP 442

  Fly   266 WECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRA 330
            ::|:.|||.|..:.||.:|:|:||||.||.||.|.:.|:.:.|..:|...|:|.:|:.|..||:|
Human   443 FKCNKCSKVFGRQSFLIEHQRIHTGEKPYQCEECGKAFSHRISLTRHKRIHTEDRPYECDQCGKA 507

  Fly   331 FKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTF-------- 387
            |.:.:.|..|:|||:||||:.|:.|||.|.||.|.::|.|.|||..||:|..|.|.|        
Human   508 FSQSAHLAQHERIHTGEKPYTCKTCGKAFSQRTSLILHERSHTGEKPYECNECGKAFSSGSDLIR 572

  Fly   388 --RYKVSQRTHRC 398
              |...|::.:.|
Human   573 HQRSHSSEKPYEC 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
zf-H2C2_2 281..304 CDD:290200 12/22 (55%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
zf-H2C2_2 339..361 CDD:290200 13/21 (62%)
C2H2 Zn finger 352..372 CDD:275368 10/19 (53%)
zf-H2C2_2 364..389 CDD:290200 12/34 (35%)
C2H2 Zn finger 380..396 CDD:275368 6/25 (24%)
ZNF667NP_001308285.1 KRAB 15..74 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..139
COG5048 141..601 CDD:227381 108/403 (27%)
C2H2 Zn finger 146..166 CDD:275368
C2H2 Zn finger 174..194 CDD:275368
C2H2 Zn finger 202..222 CDD:275368
C2H2 Zn finger 255..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 284..303 CDD:275368 7/32 (22%)
C2H2 Zn finger 332..352 CDD:275368 5/20 (25%)
C2H2 Zn finger 360..380 CDD:275368 8/19 (42%)
C2H2 Zn finger 388..408 CDD:275368 2/19 (11%)
C2H2 Zn finger 417..437 CDD:275368 6/38 (16%)
C2H2 Zn finger 445..465 CDD:275368 9/19 (47%)
C2H2 Zn finger 473..493 CDD:275368 6/19 (32%)
C2H2 Zn finger 501..521 CDD:275368 8/19 (42%)
C2H2 Zn finger 529..549 CDD:275368 10/19 (53%)
C2H2 Zn finger 557..577 CDD:275368 5/19 (26%)
C2H2 Zn finger 585..605 CDD:275368 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.