DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and sens

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster


Alignment Length:436 Identity:98/436 - (22%)
Similarity:163/436 - (37%) Gaps:107/436 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCSTSVLCPLCAVPSFGSIDALQQRLIKAANGPLACPFANC-----KELFLGLDKLTIHLFSHTS 60
            |.|.:|..|..:..:..|....||:..::....:..|.:.|     :|.: ||.           
  Fly   177 MTSLNVTPPPLSAVNLKSSSTPQQQRQRSQGNIIWSPASMCERSARREQY-GLK----------- 229

  Fly    61 LMAQEGNESPANGQPASSRGFLAAAPPKRRAKRTRSKPVVPTPPPVRTTPPAHC--DICEFSF-- 121
             |.::|:|......|. .|.|       :..:||.|...:.:|....:.|.::.  |: ||..  
  Fly   230 -MEEQGDEEEHQVDPI-VRKF-------KYERRTASISSLQSPISSLSAPASNAVQDL-EFEVAQ 284

  Fly   122 ----------------RNTELRDMHVRLVHENAEGEPKQKEPQQKEPDQEPYKCHLCSKTFRMKG 170
                            .|.||...|::|..|    :|:|::.|.:..|::               
  Fly   285 QQLYAHRSAFMAGLTGNNLELLTQHLKLKSE----QPQQQQQQHRIKDEQ--------------- 330

  Fly   171 SLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCT 235
                                  ...:.:.|:..:.|.|            .|.|.:.|.:     
  Fly   331 ----------------------QQDNRSAAALMNLVAA------------AEFGYMRNQH----- 356

  Fly   236 ASQPYALSGALSMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICA 300
             .||..........||.|...:.....|.....||..:|.::..:..:::...:|. .:.|:.|.
  Fly   357 -QQPQQQQQQQLHHQQQPQQHQHQQQHPDSTATDVARRSSSSSSYQGENEEKRSGR-NFQCKQCG 419

  Fly   301 RTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSF 365
            ::|....:...|||.||:.:|:.|..||:.|.:.|.:..|..||:||||.||.||.|.|.|..:.
  Fly   420 KSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCLKAFSQSSNL 484

  Fly   366 LVHTRIHTGVMPYKCELCQKTFRYKVSQRTHRCPTEEAQTPEQLIK 411
            :.|.|.|||..|:.|.||.::|:.||..|.||....|...|.:.:|
  Fly   485 ITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHRESRHEEAPPVEDLK 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 3/19 (16%)
zf-H2C2_2 281..304 CDD:290200 3/22 (14%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 339..361 CDD:290200 13/21 (62%)
C2H2 Zn finger 352..372 CDD:275368 8/19 (42%)
zf-H2C2_2 364..389 CDD:290200 10/24 (42%)
C2H2 Zn finger 380..396 CDD:275368 7/15 (47%)
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 6/21 (29%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
COG5048 423..>497 CDD:227381 30/73 (41%)
zf-H2C2_2 428..452 CDD:290200 10/23 (43%)
C2H2 Zn finger 443..463 CDD:275368 6/19 (32%)
zf-H2C2_2 455..480 CDD:290200 13/24 (54%)
C2H2 Zn finger 471..491 CDD:275368 8/19 (42%)
C2H2 Zn finger 499..516 CDD:275368 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.