DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG3281

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:446 Identity:100/446 - (22%)
Similarity:160/446 - (35%) Gaps:107/446 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 HCDICEF----------SFRNTELRDMHVRL----------------------VHENAEGEPKQK 145
            |.|:.|.          .:.:|...:.||.:                      ..|:.:.||:..
  Fly   106 HVDVVELIDQDDVVSMAQYLSTSFAEQHVEMEEKYGDQDCSAFTSDVGEEPLYASEDRDDEPEDS 170

  Fly   146 EPQQKEPDQ-------EP--------------YKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNP 189
            ...:..||:       .|              |||.:|.:.|....||..|....|.:       
  Fly   171 FQLKPRPDEIENRELSRPSQLGSRLNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKL------- 228

  Fly   190 NPNPNPSPTPASTTSAVTATPKLSICDRI--------RHTEPGALGNGNNSTCTASQPYALSGAL 246
              ..:.:....:..|..|.......|.|.        ||.:             |..|.|:  ||
  Fly   229 --TADVAAMKLANESCGTGLLTCEHCPRTFKRQDTLRRHMQ-------------AFHPDAI--AL 276

  Fly   247 SMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHK 311
            ...:.:.:|.....|  |..:|..|..||... .|..|.|.|||:.||.|:.|.:.|...|....
  Fly   277 EPEETTDNSARKRIA--KRRDCPHCGLSFPVS-SLTIHIRRHTGDNPYKCDQCEKAFPRSQDLSL 338

  Fly   312 HLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVM 376
            |:..|:..:|..|.:|.:.|...:.|..|.|:|:|::|:.|::|.|.|.|.....:|.|.|||..
  Fly   339 HMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGER 403

  Fly   377 PYKCELCQKTFRYKVSQRTHRCPTEEAQTPEQLIKAFLEGNDSHTQPSPASAEIAAINSSSIVDP 441
            ||:|.:|.::|........||      .....|| |.:.||:.....:......|.:|.....|.
  Fly   404 PYQCGVCGESFVCGSHLNIHR------NRKGHLI-AVIPGNEVEANFAADPYVNARVNQRRSEDI 461

  Fly   442 EQ-------EALLSQSIDDI----VVEQCQKLGICGVEPREEGQLISLQPVAVVHF 486
            |:       |..|.|.::::    |...|.|.|:| .:..:.|.|:::....:.|:
  Fly   462 ERMRLQRIPENQLQQRLENLPKPDVPAMCYKCGVC-EQKFKSGALLTVHRNKMSHY 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
zf-H2C2_2 281..304 CDD:290200 10/22 (45%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 339..361 CDD:290200 9/21 (43%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
zf-H2C2_2 364..389 CDD:290200 10/24 (42%)
C2H2 Zn finger 380..396 CDD:275368 3/15 (20%)
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 6/20 (30%)
C2H2 Zn finger 249..266 CDD:275368 3/16 (19%)
COG5048 <294..>391 CDD:227381 33/97 (34%)
C2H2 Zn finger 296..315 CDD:275368 7/19 (37%)
zf-H2C2_2 307..330 CDD:290200 10/22 (45%)
C2H2 Zn finger 323..343 CDD:275368 5/19 (26%)
zf-H2C2_2 335..358 CDD:290200 5/22 (23%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
zf-H2C2_2 364..388 CDD:290200 10/23 (43%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
zf-H2C2_2 391..416 CDD:290200 10/24 (42%)
C2H2 Zn finger 407..424 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2696
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.