DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG31388

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:294 Identity:61/294 - (20%)
Similarity:103/294 - (35%) Gaps:69/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 RTTPPAH-CDICEFSFRNTELRDMHVRLVHENAEGEPKQKEPQQKEPDQEPYKCHLCSKTFRMKG 170
            |.|..:| |..|...|.|.:...:|...:|:              .|....:.|..|.:.||...
  Fly   189 RDTSSSHTCSKCGLEFENVDELKLHKYHLHD--------------IPPDTKFVCDHCDEGFRSAA 239

  Fly   171 SLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCT 235
            :|..|..::::               |...|.|.          |....|..  .|...:...|.
  Fly   240 ALTRHCNMINL---------------PLTHSCTK----------CKSQFHNH--ILLETHKQRCL 277

  Fly   236 ASQPYALSGALSMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICA 300
                           :.|:|..         .|.:|.|..||.:.||.|...|.|...:.|:.|:
  Fly   278 ---------------RPPASQH---------VCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCS 318

  Fly   301 RTFTFQQSYHKHLLYHSEVKPHVCGV-CGRAFKELSTLHNHQRIH--SGEKPFKCEVCGKCFRQR 362
            .:|........|...|:..:|::|.. ||:.|:..|....|:|:|  :.::.::||.|.|.:...
  Fly   319 ASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTP 383

  Fly   363 VSFLVHTRIHTGVMPYKCELCQKTFRYKVSQRTH 396
            .....|.:.|.....:.||:|:.:|:.....|:|
  Fly   384 SECRTHQKYHNLTRDHGCEICRISFKTAKHYRSH 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
zf-H2C2_2 281..304 CDD:290200 7/22 (32%)
C2H2 Zn finger 324..344 CDD:275368 7/20 (35%)
zf-H2C2_2 339..361 CDD:290200 7/23 (30%)
C2H2 Zn finger 352..372 CDD:275368 5/19 (26%)
zf-H2C2_2 364..389 CDD:290200 6/24 (25%)
C2H2 Zn finger 380..396 CDD:275368 5/15 (33%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 7/40 (18%)
C2H2 Zn finger 286..306 CDD:275368 8/19 (42%)
C2H2 Zn finger 314..334 CDD:275368 4/19 (21%)
C2H2 Zn finger 342..363 CDD:275368 7/20 (35%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..419 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.