DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and hkb

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster


Alignment Length:230 Identity:57/230 - (24%)
Similarity:90/230 - (39%) Gaps:62/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 PCSNPNPNP---NPSPTPASTTSAVTAT--------PKLSICDRIRHTEPGALGNGNNSTCTASQ 238
            |..:..|:|   :|..:|..|.:|.||:        |.||....:.:....|      :...||.
  Fly    93 PLLDAAPHPVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAA------AAAAAST 151

  Fly   239 PYALSG------ALSMLQQSPS----------SPESGTATPKLWECDVCSKSFTTKYFLKKHKRL 287
            |.|:.|      .:.:::|..:          :..|....||.::|..|..:|:....||.|.|:
  Fly   152 PTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNCDVAFSNNGQLKGHIRI 216

  Fly   288 HTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKC 352
            ||||.|:.|::                          ..||:.|.....|..|:|||:|.:|:.|
  Fly   217 HTGERPFKCDV--------------------------NTCGKTFTRNEELTRHKRIHTGLRPYPC 255

  Fly   353 EVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTF 387
            ..|||.|.:|.....|.:.|   ||.:.:|....|
  Fly   256 SACGKKFGRRDHLKKHMKTH---MPQERQLGPSIF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
zf-H2C2_2 281..304 CDD:290200 10/22 (45%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 339..361 CDD:290200 11/21 (52%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
zf-H2C2_2 364..389 CDD:290200 6/24 (25%)
C2H2 Zn finger 380..396 CDD:275368 2/8 (25%)
hkbNP_524221.1 COG5048 195..>261 CDD:227381 26/91 (29%)
zf-C2H2 195..217 CDD:278523 7/21 (33%)
C2H2 Zn finger 197..217 CDD:275368 7/19 (37%)
zf-H2C2_2 210..236 CDD:290200 13/51 (25%)
C2H2 Zn finger 225..247 CDD:275368 7/47 (15%)
zf-H2C2_2 239..264 CDD:290200 12/24 (50%)
C2H2 Zn finger 255..275 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.