DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG17359

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:320 Identity:86/320 - (26%)
Similarity:122/320 - (38%) Gaps:82/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PVRTTPPAHCDICEFSFRNTELRDMHVRLVHENAEGEPKQKEPQQKEPDQEPYKC-HLCSKTFRM 168
            ||..|....|..|.               ||:. :|.|:....:..|..:..|:. ..|.|:.:.
  Fly    36 PVLATMLRECSGCS---------------VHKE-DGMPQFICVECAEAVRNAYRLRRQCRKSHQY 84

  Fly   169 KGSLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSA----VTATPKLSICDRIRHTEP------ 223
            ...||:.:|.:..:.. |.|...|..|. .|.|...|    .|:.|.|....::::..|      
  Fly    85 FEQLRLMMKELDDIEY-CLNIGDNIEPQ-MPVSVMEAGKTPETSEPLLVELVQVKYMPPEPKPIS 147

  Fly   224 GALGNGN-----NSTCTASQPYALS--GALSMLQQSPSSPESGTA---TPKLW------------ 266
            ..|.:.|     .|...|..|:..|  .|.|.......||:|...   ..|:|            
  Fly   148 SPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKRVP 212

  Fly   267 ---ECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCG 328
               .|.:|::|||.|..|:.|.|:||||.||.|.:|.|:|.                        
  Fly   213 GPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFA------------------------ 253

  Fly   329 RAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTFR 388
                :...|.:|.|.|:||:||.|..|.|.|||.....||||.|||..|:||..||::|:
  Fly   254 ----QKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
zf-H2C2_2 281..304 CDD:290200 12/22 (55%)
C2H2 Zn finger 324..344 CDD:275368 3/19 (16%)
zf-H2C2_2 339..361 CDD:290200 11/21 (52%)
C2H2 Zn finger 352..372 CDD:275368 10/19 (53%)
zf-H2C2_2 364..389 CDD:290200 13/25 (52%)
C2H2 Zn finger 380..396 CDD:275368 4/9 (44%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 13/67 (19%)
zf-C2H2 215..237 CDD:278523 9/21 (43%)
C2H2 Zn finger 217..237 CDD:275368 9/19 (47%)
zf-H2C2_2 229..254 CDD:290200 13/52 (25%)
C2H2 Zn finger 245..265 CDD:275368 7/47 (15%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 10/19 (53%)
zf-H2C2_2 286..310 CDD:290200 13/24 (54%)
C2H2 Zn finger 301..321 CDD:275368 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.