DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG17568

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:377 Identity:82/377 - (21%)
Similarity:132/377 - (35%) Gaps:122/377 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EGNES--PANGQ------PASSRGFLAAAPPKRRAKRTRSKPVVPTPPPVRTTPPAHCDICEFSF 121
            ||::.  |.:||      .|::...|.:. .:.:|||.|                ..|:.|...:
  Fly   237 EGDDDFLPVDGQLMDLVAVATTPNTLEST-AEEKAKRGR----------------MDCEKCGKVY 284

  Fly   122 RNTELRDMHVRLVHENAEGEPKQKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPC 186
            ||....:.|:       |.|.::.|.:.| .|:....|.:|:||.....:|::|.:.:|.     
  Fly   285 RNRASYEKHL-------ERECRRIERRVK-VDKTTTTCDICNKTLSSATALKLHKEGIHQ----- 336

  Fly   187 SNPNPNPNPSPTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQ 251
                   |..|                                                      
  Fly   337 -------NVKP------------------------------------------------------ 340

  Fly   252 SPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYH 316
                          :.||.|.|...|...|.:||.:||...|:.|.:|...|..:.....|...|
  Fly   341 --------------YICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIH 391

  Fly   317 SEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCE 381
            :| ...||.:||:..:...|.:.|:.:|:.|:..||:|||..|::..:...|...|||:.||.|.
  Fly   392 AE-PSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCN 455

  Fly   382 LCQKTFRYKVSQRTHRC---PTE-----EAQTPEQLIKAFLEGNDSHTQPSP 425
            .|.|:|....:.|:|:.   |.|     .|:.|.:|....|:.....||..|
  Fly   456 YCGKSFACNANCRSHKLKKHPQEVQQEDGARLPSRLNVPTLDELRVMTQKLP 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
zf-H2C2_2 281..304 CDD:290200 8/22 (36%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
zf-H2C2_2 339..361 CDD:290200 9/21 (43%)
C2H2 Zn finger 352..372 CDD:275368 6/19 (32%)
zf-H2C2_2 364..389 CDD:290200 10/24 (42%)
C2H2 Zn finger 380..396 CDD:275368 5/15 (33%)
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 51/238 (21%)
C2H2 Zn finger 314..335 CDD:275368 6/20 (30%)
C2H2 Zn finger 343..363 CDD:275368 8/19 (42%)
C2H2 Zn finger 371..391 CDD:275368 4/19 (21%)
C2H2 Zn finger 398..418 CDD:275368 5/19 (26%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
zf-H2C2_2 439..463 CDD:290200 10/23 (43%)
C2H2 Zn finger 454..475 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.