| Sequence 1: | NP_649494.1 | Gene: | CG14655 / 40594 | FlyBaseID: | FBgn0037275 | Length: | 525 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_608840.1 | Gene: | CG15436 / 33657 | FlyBaseID: | FBgn0031610 | Length: | 346 | Species: | Drosophila melanogaster |
| Alignment Length: | 255 | Identity: | 71/255 - (27%) |
|---|---|---|---|
| Similarity: | 106/255 - (41%) | Gaps: | 67/255 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 157 YKCHLCSKTFRMKGSLRIHLKVVHMMG--VPCSNPNPNPNPSPTPASTTSAVTATPKLSICDRIR 219
Fly 220 HTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKH 284
Fly 285 KRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKP 349
Fly 350 FKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTFR-------YKV---SQRTHRCP 399 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14655 | NP_649494.1 | C2H2 Zn finger | 268..288 | CDD:275368 | 7/19 (37%) |
| zf-H2C2_2 | 281..304 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 324..344 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 339..361 | CDD:290200 | 13/21 (62%) | ||
| C2H2 Zn finger | 352..372 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 364..389 | CDD:290200 | 10/31 (32%) | ||
| C2H2 Zn finger | 380..396 | CDD:275368 | 8/25 (32%) | ||
| CG15436 | NP_608840.1 | zf-AD | 4..78 | CDD:285071 | |
| C2H2 Zn finger | 128..148 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 156..176 | CDD:275368 | 5/47 (11%) | ||
| COG5048 | <180..341 | CDD:227381 | 54/172 (31%) | ||
| C2H2 Zn finger | 184..204 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 197..219 | CDD:290200 | 10/21 (48%) | ||
| C2H2 Zn finger | 212..232 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 224..249 | CDD:290200 | 6/24 (25%) | ||
| C2H2 Zn finger | 240..260 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 252..276 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 296..316 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 324..341 | CDD:275368 | 2/2 (100%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24390 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||