DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG17612

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster


Alignment Length:330 Identity:63/330 - (19%)
Similarity:112/330 - (33%) Gaps:124/330 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DICEFSFRNTELRDMHVRLVHE------NAEGEPKQKEPQQKE-PDQEPYKCHLCSKTFRMKGSL 172
            |:.:.:|.:.|.::..:::..:      :.:..|.:.:|...| ..:.|::|..|.|.|.:...|
  Fly   239 DVVKNAFDDLESKENTIQMYRQPKEEIIDIDSIPVKNKPVDYEVTGKPPHRCPQCPKIFLLAAKL 303

  Fly   173 RIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCTAS 237
            :.|:: .|                                   :..|.|||              
  Fly   304 QAHIR-TH-----------------------------------NETRTTEP-------------- 318

  Fly   238 QPYALSGALSMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTG--------EMPY 294
                                     |:| :|.:|...:..:..|:.|..:|..        |.||
  Fly   319 -------------------------PRL-KCPMCPSIYMKRGCLEAHMWIHRASDERESELEPPY 357

  Fly   295 TCEICARTFTFQQSYHKHLLYHSEV-------KPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKC 352
            .|..|.:.|.:......|:..|.:|       ..|.|..|...|.::|:|.:|.:||:||:.|||
  Fly   358 RCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFSDVSSLKDHVKIHAGERTFKC 422

  Fly   353 EVCGKCFRQRVSF----LVHTRI----------------------HTGVMPYKCELCQKTFRYKV 391
            .:|...|::..:.    ..|||.                      ||...|:||..||:||:.:.
  Fly   423 PLCLMSFQEESNLKSHDCAHTRFKCHKCSKFFESQNYLDFHFKKSHTTKGPFKCIKCQQTFQKRN 487

  Fly   392 SQRTH 396
            ..:.|
  Fly   488 GLKEH 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 4/19 (21%)
zf-H2C2_2 281..304 CDD:290200 8/30 (27%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 339..361 CDD:290200 10/21 (48%)
C2H2 Zn finger 352..372 CDD:275368 6/45 (13%)
zf-H2C2_2 364..389 CDD:290200 12/50 (24%)
C2H2 Zn finger 380..396 CDD:275368 5/15 (33%)
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 1/6 (17%)
C2H2 Zn finger 290..310 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275370 4/19 (21%)
zf-C2H2_8 356..438 CDD:292531 24/81 (30%)
C2H2 Zn finger 359..379 CDD:275368 4/19 (21%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
C2H2 Zn finger 422..438 CDD:275368 3/15 (20%)
C2H2 Zn finger 447..463 CDD:275368 0/15 (0%)
C2H2 Zn finger 476..505 CDD:275368 6/17 (35%)
C2H2 Zn finger 513..533 CDD:275368
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 568..584 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.