DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and odd

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster


Alignment Length:406 Identity:101/406 - (24%)
Similarity:158/406 - (38%) Gaps:112/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PVVPTPPPVRTTPPAHCDICEFSFRNTELRDMHVRLVHENAEGEPKQKE-------PQQKEPDQE 155
            |..||..|:|...||   |.|.:.. |:|...|:....:..:.:.:|::       .||::..|.
  Fly    49 PHTPTEEPLRRVHPA---ISEEAVA-TQLHMRHMAHYQQQQQQQQQQQQHRLWLQMQQQQQQHQA 109

  Fly   156 P--YKCHLCSKT-------------------FRMKGSLRIHLKVVHMMGVPCSNPNPNP-NPSPT 198
            |  |..:..:..                   ::.:...:.|....|..|.| .:|:|:| :..|.
  Fly   110 PQQYPVYPTASADPVAVHQQLMNHWIRNAAIYQQQQQQQQHPHHHHHHGHP-HHPHPHPHHVRPY 173

  Fly   199 PA---STTSAVT-----ATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSS 255
            ||   |..:||.     |.|.|.:         |..|..             ||.       ||.
  Fly   174 PAGLHSLHAAVMGRHFGAMPTLKL---------GGAGGA-------------SGV-------PSG 209

  Fly   256 PESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVK 320
            ....:...|.:.|..|::.||..|.|..|:|.||.|.||:|:|                      
  Fly   210 ATGSSRPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSCDI---------------------- 252

  Fly   321 PHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQK 385
                  ||:||:....|.:|:.|||.:|||||..|||.|.|..:..||...|....|:||.:||:
  Fly   253 ------CGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQR 311

  Fly   386 TFRYKVSQRTHRCPTEEAQTPEQLIKAFLEGNDSHTQP-----SPASAEIAA------INSSSIV 439
            :|..:.:.::|.....|..|.|.::..  ....||:.|     ||....:|.      ::|||..
  Fly   312 SFNQRANLKSHLQSHSEQSTKEVVVTT--SPATSHSVPNQALSSPQPENLAQHLPVLDLSSSSSS 374

  Fly   440 DPEQEALLSQSIDDIV 455
            ..:.:.:|..:||:|:
  Fly   375 SEKPKRMLGFTIDEIM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
zf-H2C2_2 281..304 CDD:290200 10/22 (45%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 339..361 CDD:290200 13/21 (62%)
C2H2 Zn finger 352..372 CDD:275368 8/19 (42%)
zf-H2C2_2 364..389 CDD:290200 9/24 (38%)
C2H2 Zn finger 380..396 CDD:275368 4/15 (27%)
oddNP_722922.1 COG5048 <203..334 CDD:227381 51/178 (29%)
C2H2 Zn finger 222..242 CDD:275368 8/19 (42%)
zf-H2C2_2 234..259 CDD:290200 14/52 (27%)
C2H2 Zn finger 250..270 CDD:275368 8/47 (17%)
zf-H2C2_2 262..285 CDD:290200 13/22 (59%)
C2H2 Zn finger 278..298 CDD:275368 8/19 (42%)
zf-C2H2 304..326 CDD:278523 6/21 (29%)
C2H2 Zn finger 306..326 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.