DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG11695

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:591 Identity:117/591 - (19%)
Similarity:181/591 - (30%) Gaps:230/591 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLCPLC------AVPSFGSIDALQQ--------------RLIKAANGPLA--------------- 35
            ::|.||      :||.|...|:..|              :|:...|..::               
  Fly     1 MICRLCLDDAEHSVPIFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLADFE 65

  Fly    36 --CPFANCKELFLGLDKLTIHLFSHTS--------LMAQEGNESP--ANGQPASSRGFLAAAPPK 88
              |.....|:  |||.:|.:..||...        |...|.:.||  |:.:..:.....|::..:
  Fly    66 QFCAMVMKKQ--LGLQQLKMEPFSEDEDADTKAQILCEPEIDVSPAAADNEECNEIDGDASSNSR 128

  Fly    89 RRAKRTRSKPVVPTPPPVR--------TTPPAHCDICEFSFRNTELRDMHVRL-VH-------EN 137
            ..:.||.|...:..|.|:|        .|.|           .|:......|. .|       |:
  Fly   129 SSSIRTTSLREMRLPSPIRRRMRLPRAVTAP-----------KTQAVKAKARTKTHKAEADEDED 182

  Fly   138 AEGE--PKQKEPQQKEPDQEPY-------KCHLC--SKTFRMKGSLRIHLKVVHM-MG-VPCSNP 189
            ||||  |:.:....:|.|.  |       :|.:|  .:.|.....::.|.:..|. :| |.|   
  Fly   183 AEGEGDPESRSSNSREMDS--YIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVC--- 242

  Fly   190 NPNPNPSPTPASTTSAVTATPKLSICDR------------IRHTEPGALGNGNNSTCTASQPYAL 242
                                     |.|            ..|.:|...   ....|:......:
  Fly   243 -------------------------CQRRYKKRALYVDHLHMHNDPNYF---RCKICSKQLVSRI 279

  Fly   243 SGALSMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQ 307
            |..:.||:..|:..:...|      ||.|||.|:.::.|..|.|:|..|....|:.|.|:|....
  Fly   280 SYDVHMLRFHPNKDDLSFA------CDQCSKRFSKQFLLTIHSRVHQQERNEQCKHCDRSFRTAV 338

  Fly   308 SYHKHL--LYHSEVKPHVCGVCGRAFKELSTLHNHQR-IH------------------SGE---- 347
            ....|:  .:.....|.:|..||..||....|..|:| :|                  |.|    
  Fly   339 DLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLR 403

  Fly   348 ------------KPFKCEVCG----------------------KC------FRQRVSFLVHTRIH 372
                        :.:|||.||                      ||      |:...|...||..|
  Fly   404 KHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKEFKSSRSLEEHTATH 468

  Fly   373 TGVMPYKCELCQKTFRYKVSQRTHRCPTEEAQTPEQLIKAFLEGNDSHTQPSPASAEIAAINSSS 437
            ||...|:|..|::||:...:...||                   ...|      :|::||:....
  Fly   469 TGQDLYECAFCERTFKNSGNMHKHR-------------------RQMH------AAQVAALQQQK 508

  Fly   438 IVDPEQ 443
            .|.|.:
  Fly   509 KVPPSK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
zf-H2C2_2 281..304 CDD:290200 8/22 (36%)
C2H2 Zn finger 324..344 CDD:275368 8/20 (40%)
zf-H2C2_2 339..361 CDD:290200 13/84 (15%)
C2H2 Zn finger 352..372 CDD:275368 10/47 (21%)
zf-H2C2_2 364..389 CDD:290200 11/24 (46%)
C2H2 Zn finger 380..396 CDD:275368 4/15 (27%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 15/80 (19%)
C2H2 Zn finger 268..289 CDD:275368 4/20 (20%)
C2H2 Zn finger 299..319 CDD:275368 9/19 (47%)
C2H2 Zn finger 327..348 CDD:275368 5/20 (25%)
C2H2 Zn finger 357..376 CDD:275368 7/18 (39%)
C2H2 Zn finger 389..409 CDD:275368 2/19 (11%)
C2H2 Zn finger 420..440 CDD:275368 4/19 (21%)
C2H2 Zn finger 448..468 CDD:275368 5/19 (26%)
C2H2 Zn finger 476..494 CDD:275368 6/36 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.