DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG11696

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:486 Identity:104/486 - (21%)
Similarity:167/486 - (34%) Gaps:171/486 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QEGNESPANGQPASSRGFL---AAAPPKRRAKRTR--SKPVV-------PTPPPVRTTP------ 110
            |:|:|...:.:...  |.|   |...||.|.||.|  :|.:|       .:..||:.:.      
  Fly   230 QDGDEDEEDEEDVG--GELTPDADEQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDD 292

  Fly   111 ------PAHCDICEFSFRNTELRDMHVRLVHENAEGEPK------------------QKEPQQKE 151
                  ...|.||.....:......|.|:.|: ..|..|                  .|:||.  
  Fly   293 YIAANVKLDCAICAAPLEDFNDLKRHFRVEHD-CTGYVKCCNNRYKKRTLYVDHLHCHKDPQY-- 354

  Fly   152 PDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVTATPKLSICD 216
                 :.|..|.|.|..:.|     :|:||:..                                
  Fly   355 -----FSCQSCRKNFLNRNS-----QVMHMLRF-------------------------------- 377

  Fly   217 RIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFL 281
               |::...|.: ..:.|.|.  :|....|:|..:.    ..||..|::  ||.|||:|.||:.|
  Fly   378 ---HSQQQELVH-QCAICEAR--FAKKFLLTMHLKG----HKGTERPEV--CDTCSKTFRTKFEL 430

  Fly   282 KKH-KRLHTGEM-PYTCEICARTFTFQQSY--HKHLLYH----SEVKPHVCGVCGRAFKE----- 333
            ..| ||:|..:. |..|:||...|..:.::  ||..|:.    :||:   |.:|||..::     
  Fly   431 SAHVKRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQ---CTLCGRWLRDERSLR 492

  Fly   334 --------------------------LSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIH 372
                                      .:.|.:|.|.|...|..||.:|.|.|:...:...|...|
  Fly   493 KHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATH 557

  Fly   373 TGVMPYKCELCQKTFRYKVSQRTHRCPTEEAQTPEQLIKAFLEGNDSHT-------------QPS 424
            ||:..|:|:.|.:||:...:...|:    :...|...::.:.:.:.|.|             ||:
  Fly   558 TGIDLYQCQFCTRTFKSHANMHNHK----KKMHPNDWVRKYSQPSSSITSTAAPLAHPNHPNQPA 618

  Fly   425 PASA-----------EIAAINSSSIVDPEQE 444
            |.:|           .:..|..|.|..|:.|
  Fly   619 PPAAAPTNLAGHMLPPLGGIAKSLIEIPDTE 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 12/20 (60%)
zf-H2C2_2 281..304 CDD:290200 9/24 (38%)
C2H2 Zn finger 324..344 CDD:275368 7/50 (14%)
zf-H2C2_2 339..361 CDD:290200 9/21 (43%)
C2H2 Zn finger 352..372 CDD:275368 5/19 (26%)
zf-H2C2_2 364..389 CDD:290200 9/24 (38%)
C2H2 Zn finger 380..396 CDD:275368 4/15 (27%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 0/16 (0%)
C2H2 Zn finger 357..378 CDD:275368 8/60 (13%)
C2H2 Zn finger 388..408 CDD:275368 5/25 (20%)
C2H2 Zn finger 417..438 CDD:275368 12/20 (60%)
C2H2 Zn finger 447..465 CDD:275368 5/17 (29%)
C2H2 Zn finger 478..498 CDD:275368 4/19 (21%)
C2H2 Zn finger 509..529 CDD:275368 3/19 (16%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 565..583 CDD:275368 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.