DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG18262

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:373 Identity:90/373 - (24%)
Similarity:135/373 - (36%) Gaps:115/373 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 CDICEFSFRNTELRDMHVRLVHENAEG-----EPKQKEPQQKEPDQEPYKCH--LCSKTFRMKGS 171
            ||.|:.::........|.||.|..|.|     ...::..::::...:.|||:  .|::|||.:..
  Fly   174 CDQCDRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSKKRKGPPKVYKCNEEACNQTFRTERD 238

  Fly   172 LRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCTA 236
            ||.|                                         |.:||               
  Fly   239 LRGH-----------------------------------------RWKHT--------------- 247

  Fly   237 SQPYALSGALSMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICAR 301
                   |..                     ||:|.|.||....:.:|::.|:|..|:.|..|..
  Fly   248 -------GIF---------------------CDICGKPFTQSGNMMRHRQRHSGIKPHKCPECDA 284

  Fly   302 TFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFL 366
            ||..|:....|.:.|:...|.:|.||||..::...|..|.|.|:||:|.|||||||.|.......
  Fly   285 TFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLN 349

  Fly   367 VHTRIHTGVMPYKCELCQKTFRYKVSQRTHR-------------CPTEEAQTPEQLIKAFLEGND 418
            ||...||.:.|:.|::|..||:.|.:.|.|:             |....||:..  :.|.:..:|
  Fly   350 VHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQSGG--LNAHMRSHD 412

  Fly   419 -----SHTQPSPASAEIAAINSSSIVDPEQEALLSQSIDDIVVEQCQK 461
                 ...:|.|.|..|..|...|    .....::.:||..|.||..|
  Fly   413 PARVKGAVKPLPQSVTIEVIEGKS----PPTTTITMAIDLNVEEQLVK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
zf-H2C2_2 281..304 CDD:290200 7/22 (32%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
zf-H2C2_2 339..361 CDD:290200 14/21 (67%)
C2H2 Zn finger 352..372 CDD:275368 9/19 (47%)
zf-H2C2_2 364..389 CDD:290200 9/24 (38%)
C2H2 Zn finger 380..396 CDD:275368 6/15 (40%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 9/62 (15%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
COG5048 <256..415 CDD:227381 52/160 (33%)
zf-H2C2_2 263..288 CDD:290200 8/24 (33%)
C2H2 Zn finger 279..327 CDD:275368 16/47 (34%)
zf-H2C2_2 320..342 CDD:290200 14/21 (67%)
C2H2 Zn finger 335..355 CDD:275368 9/19 (47%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-C2H2 389..411 CDD:278523 4/23 (17%)
C2H2 Zn finger 391..411 CDD:275368 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.