DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG2129

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster


Alignment Length:305 Identity:78/305 - (25%)
Similarity:114/305 - (37%) Gaps:69/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PAHCDICEFSFRNTELRDMHVRLVH----------ENAEGEPKQKEPQQKEPDQEPYKCHLCSKT 165
            |..|..|...:::.::.:.|:...|          |:|:.||.:..| .|...|| |||..|.|.
  Fly   180 PHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAP-VKSAAQE-YKCEHCGKI 242

  Fly   166 FRMKGSLRIHLKVVHMMG----------VPCSNPNPNPNPSPTPASTTSAVTATPKLSICDRIRH 220
            :..|.|||.|||..|..|          :.|.                   ...|:|.:.|    
  Fly   243 YHGKYSLRQHLKRDHDNGEEGGSAIFTCLECE-------------------AQLPRLRLLD---- 284

  Fly   221 TEPGALGNGNNSTCTASQPYALSGALSMLQQSPSS------PESGT-----------------AT 262
             |.....:|..:.....:.|.....|...|...:|      |..|.                 ..
  Fly   285 -EHMVQAHGGAACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIRHMRNHGKVHTE 348

  Fly   263 PKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVC 327
            .|.:.|:.|..|...|..|:.|.|.||||.|:.|::|.:.|.......:|:..||..:||||.||
  Fly   349 QKNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVC 413

  Fly   328 GRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIH 372
            |..|.....|::|:.:|:..|.|.|::||..:.|......|.|.|
  Fly   414 GATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRKH 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
zf-H2C2_2 281..304 CDD:290200 10/22 (45%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
zf-H2C2_2 339..361 CDD:290200 7/21 (33%)
C2H2 Zn finger 352..372 CDD:275368 6/19 (32%)
zf-H2C2_2 364..389 CDD:290200 3/9 (33%)
C2H2 Zn finger 380..396 CDD:275368
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 3/19 (16%)
zf-C2H2_8 323..411 CDD:292531 24/87 (28%)
C2H2 Zn finger 327..346 CDD:275368 1/18 (6%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 367..389 CDD:290200 10/21 (48%)
C2H2 Zn finger 382..402 CDD:275368 4/19 (21%)
zf-H2C2_2 395..419 CDD:290200 11/23 (48%)
C2H2 Zn finger 410..430 CDD:275368 7/19 (37%)
C2H2 Zn finger 438..458 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.