DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG3032

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster


Alignment Length:330 Identity:90/330 - (27%)
Similarity:132/330 - (40%) Gaps:55/330 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 KPVVPTPPPVRTTPPA------------------HCDICEFSFRNTELRDMHVRLVHENAEGEPK 143
            :|..|.|.|.....||                  .|.:|..||.:......|:|.|||.:     
  Fly   123 EPPEPAPDPDPIDEPAIKSDKSPRKSFRGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGS----- 182

  Fly   144 QKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVTA 208
                      :.|::|..|.|.:...|.|..|::.||   .|....:|...|......|:.....
  Fly   183 ----------KRPFQCDQCEKAYSFMGGLYTHIREVH---APKERRHPCDQPGCERIYTSRIAMQ 234

  Fly   209 TPKLSICDRIRHT--EPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPE----SGTATPKLWE 267
            ..|     |::|:  :..||.......|.||...:.:....:..:.|:..|    .|.|..:.: 
  Fly   235 KHK-----RLKHSPRDRDALKKFICEQCGASFNQSANLKYHLKTKHPTEDEVAAREGGAGERHF- 293

  Fly   268 CDVCSKSFTTKYFLKKHK-RLH--TGEMPYTCEICARTFTFQQSYHKHLLYHSEVK-PHVCGVCG 328
            ||:|.|.|.::|.||.|. :.|  ..|:|:.|::|.|....:....:|:|.||..| |  |..||
  Fly   294 CDICQKEFHSRYTLKYHTLQQHEVQEELPHECQVCGRRMAKKFMLLQHMLMHSNDKLP--CEHCG 356

  Fly   329 RAFKELSTLHNHQR-IHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTFRYKVS 392
            |.|.....|..|.| :|...|||.|..|.:.|..|.:...|..||||..||.|:.|.:.||.:..
  Fly   357 RRFARRFELEAHVRAVHLKLKPFPCHHCPESFASRKTLRHHEYIHTGEKPYICDTCGQAFRQQTC 421

  Fly   393 QRTHR 397
            .:.||
  Fly   422 LKNHR 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 9/20 (45%)
zf-H2C2_2 281..304 CDD:290200 9/25 (36%)
C2H2 Zn finger 324..344 CDD:275368 8/20 (40%)
zf-H2C2_2 339..361 CDD:290200 9/22 (41%)
C2H2 Zn finger 352..372 CDD:275368 5/19 (26%)
zf-H2C2_2 364..389 CDD:290200 10/24 (42%)
C2H2 Zn finger 380..396 CDD:275368 4/15 (27%)
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071
C2H2 Zn finger 158..179 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..209 CDD:275368 6/20 (30%)
C2H2 Zn finger 218..239 CDD:275368 3/25 (12%)
C2H2 Zn finger 254..275 CDD:275368 3/20 (15%)
C2H2 Zn finger 294..315 CDD:275368 9/20 (45%)
C2H2 Zn finger 325..345 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..373 CDD:275368 8/20 (40%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 409..429 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2696
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.