DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG12236

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_727050.1 Gene:CG12236 / 31523 FlyBaseID:FBgn0029822 Length:553 Species:Drosophila melanogaster


Alignment Length:228 Identity:50/228 - (21%)
Similarity:80/228 - (35%) Gaps:71/228 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 EPKQKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNP---------NPNPNPS 196
            |.:.:|..|.:.|                 :..|.:::..::|.....|         :.....:
  Fly   371 ESEMEEKYQADAD-----------------NAEIAIEMTRLLGTASGTPGAGSGQVMEDSGGGSA 418

  Fly   197 PTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPESGTA 261
            .|..|||.:||....    |........||..|:.:...:|:    |||      :.|:|.:|  
  Fly   419 TTGPSTTVSVTQVKS----DSKASGTNAALKPGSVTVARSSK----SGA------TASAPPAG-- 467

  Fly   262 TPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLL-YHSEV--KPHV 323
                      |...:.:|         ||..|..|..|.|......:..:|:. .|||:  |.|.
  Fly   468 ----------SDEESVQY---------TGLAPLNCSFCGRPLKSVNALRRHIASRHSEIQGKEHE 513

  Fly   324 CGVCGRAFK---ELSTLHN---HQRIHSGEKPF 350
            |.:|.::||   .||| ||   |:.:....|.|
  Fly   514 CFICMKSFKTKWSLST-HNSRFHREMGCSTKGF 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 2/19 (11%)
zf-H2C2_2 281..304 CDD:290200 6/22 (27%)
C2H2 Zn finger 324..344 CDD:275368 10/25 (40%)
zf-H2C2_2 339..361 CDD:290200 4/15 (27%)
C2H2 Zn finger 352..372 CDD:275368
zf-H2C2_2 364..389 CDD:290200
C2H2 Zn finger 380..396 CDD:275368
CG12236NP_727050.1 BTB 22..116 CDD:279045
BTB 33..116 CDD:197585
Herpes_capsid <376..467 CDD:283714 22/121 (18%)
C2H2 Zn finger 483..512 CDD:275371 8/28 (29%)
C2H2 Zn finger 514..535 CDD:275371 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.