DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and ZBTB48

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001265576.1 Gene:ZBTB48 / 3104 HGNCID:4930 Length:688 Species:Homo sapiens


Alignment Length:482 Identity:122/482 - (25%)
Similarity:185/482 - (38%) Gaps:90/482 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PLCAVP--SFGSIDALQQRLIKAANGPLACPFANCKELFLGLDKLTIHLFSHTSLMAQEGNESPA 71
            |..|.|  |.||:.|......|....|:.||  .|.:.||....|.:|...||   .::..|.|.
Human   264 PCAAEPALSAGSLAAEPAENRKGTAVPVECP--TCHKKFLSKYYLKVHNRKHT---GEKPFECPK 323

  Fly    72 NGQPASSRGFLAAAPPKRRAKRTRSKPVVPTPPPVRTTPPAHCDICEFSFRNTELRDMHVRLVHE 136
            .|:....:..|  ...:.|....||:.|..            |.:|:.:||    |.|.:|:...
Human   324 CGKCYFRKENL--LEHEARNCMNRSEQVFT------------CSVCQETFR----RRMELRVHMV 370

  Fly   137 NAEGEPKQKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPTPAS 201
            :..||             .||||..||:.|..|..|:.|:..:|  |.      |.|:..||.|.
Human   371 SHTGE-------------MPYKCSSCSQQFMQKKDLQSHMIKLH--GA------PKPHACPTCAK 414

  Fly   202 TTSAVTAT----------PKLSICDRIRHTEPGALG----------NGNNSTCT-ASQPYALSGA 245
            ...:.|..          .||.:|:...|......|          |.....|. .|..:.....
Human   415 CFLSRTELQLHEAFKHRGEKLFVCEECGHRASSRNGLQMHIKAKHRNERPHVCEFCSHAFTQKAN 479

  Fly   246 LSMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYH 310
            |:|..::.:.       .|.::|.:|.|:|.|:..|.||.|.||||.|::||.|.:.||.:....
Human   480 LNMHLRTHTG-------EKPFQCHLCGKTFRTQASLDKHNRTHTGERPFSCEFCEQRFTEKGPLL 537

  Fly   311 KHLL-YHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTG 374
            :|:. .|.|.:||.|.:||:.||.:..|..|.|.|.|.:.|:|..||..|.::.....|..||..
Human   538 RHVASRHQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHMEIHDR 602

  Fly   375 VMPYKCELCQKTFRYKVSQRTH------RCPTE-EAQTPEQLIKAFLEGNDSHTQPSPASAEIAA 432
            |..|...  |:..|..:.:...      :.|.| |..:.|.::::..:|..:...|........:
Human   603 VENYNPR--QRKLRNLIIEDEKMVVVALQPPAELEVGSAEVIVESLAQGGLASQLPGQRLCAEES 665

  Fly   433 INSSSIVDPEQEALLSQSIDDIVVEQC 459
            .....:::|      |..|...|.|.|
Human   666 FTGPGVLEP------SLIITAAVPEDC 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
zf-H2C2_2 281..304 CDD:290200 12/22 (55%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
zf-H2C2_2 339..361 CDD:290200 9/21 (43%)
C2H2 Zn finger 352..372 CDD:275368 5/19 (26%)
zf-H2C2_2 364..389 CDD:290200 6/24 (25%)
C2H2 Zn finger 380..396 CDD:275368 2/15 (13%)
ZBTB48NP_001265576.1 BTB 16..119 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..192
C2H2 Zn finger 293..313 CDD:275368 7/21 (33%)
zf-H2C2_2 305..328 CDD:316026 7/25 (28%)
C2H2 Zn finger 321..372 CDD:275368 14/68 (21%)
SFP1 <374..459 CDD:227516 25/105 (24%)
C2H2 Zn finger 380..401 CDD:275368 7/20 (35%)
C2H2 Zn finger 409..425 CDD:275370 4/15 (27%)
C2H2 Zn finger 438..459 CDD:275368 3/20 (15%)
COG5048 <464..612 CDD:227381 50/156 (32%)
C2H2 Zn finger 467..487 CDD:275368 4/19 (21%)
C2H2 Zn finger 495..515 CDD:275368 9/19 (47%)
C2H2 Zn finger 523..540 CDD:275368 5/16 (31%)
C2H2 Zn finger 555..572 CDD:275368 7/16 (44%)
C2H2 Zn finger 580..600 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.