DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and ZNF358

DIOPT Version :9

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_060553.4 Gene:ZNF358 / 140467 HGNCID:16838 Length:568 Species:Homo sapiens


Alignment Length:382 Identity:103/382 - (26%)
Similarity:148/382 - (38%) Gaps:99/382 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 TRSKPVVPTPPPVRTTP-----PAHCDICEFSFRNTELRDMHVRLVHENAEGEPKQKEP------ 147
            |.:..|:.|.|.|...|     |..|..|..:||.:.....| |..|   .||...:.|      
Human   128 TATPQVLATSPAVLPAPASPPRPFSCPDCGRAFRRSSGLSQH-RRTH---SGEKPYRCPDCGKSF 188

  Fly   148 -------QQK--EPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTT 203
                   |.:  .....||:|..|.|.|..:.:|..|..         |:....|:..|      
Human   189 SHGATLAQHRGIHTGARPYQCAACGKAFGWRSTLLKHRS---------SHSGEKPHHCP------ 238

  Fly   204 SAVTATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPESGTATPKLWEC 268
                      :|.:       |.|:|                 |:|.|...: ..|   |:..:|
Human   239 ----------VCGK-------AFGHG-----------------SLLAQHLRT-HGG---PRPHKC 265

  Fly   269 DVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKE 333
            .||:|.|.....|.||.|.||||.||.|..|.:.|....:..:|...|:..:|:.|..||:||.:
Human   266 PVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRCPHCGKAFGQ 330

  Fly   334 LSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTFRYKVSQRTHRC 398
            .|.|.:|.|||:||:|:.|..|.|.|.|..:.|.|..:|:|..||:|:||.|.|....|...|  
Human   331 SSNLQHHLRIHTGERPYACPHCSKAFGQSSALLQHLHVHSGERPYRCQLCGKAFGQASSLTKH-- 393

  Fly   399 PTEEAQTPEQLIKAFLEGNDSHTQPSPASAEIAA--------INSSSIVDPEQEALL 447
                        |...||..:....:.|:|..||        ::.:|::.|.|.:||
Human   394 ------------KRVHEGAAAAAAAAAAAAAAAAAGLGLGPGLSPASMMRPGQVSLL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
zf-H2C2_2 281..304 CDD:290200 12/22 (55%)
C2H2 Zn finger 324..344 CDD:275368 9/19 (47%)
zf-H2C2_2 339..361 CDD:290200 11/21 (52%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
zf-H2C2_2 364..389 CDD:290200 11/24 (46%)
C2H2 Zn finger 380..396 CDD:275368 6/15 (40%)
ZNF358NP_060553.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117
COG5048 <35..339 CDD:227381 67/267 (25%)
lambda-1 108..>174 CDD:212564 14/49 (29%)
zf-C2H2 151..173 CDD:278523 6/22 (27%)
C2H2 Zn finger 153..173 CDD:275368 6/20 (30%)
zf-H2C2_2 166..190 CDD:290200 6/27 (22%)
C2H2 Zn finger 181..201 CDD:275368 2/19 (11%)
zf-H2C2_2 194..216 CDD:290200 6/21 (29%)
C2H2 Zn finger 209..229 CDD:275368 6/28 (21%)
zf-H2C2_2 222..244 CDD:290200 6/53 (11%)
C2H2 Zn finger 237..257 CDD:275368 8/60 (13%)
zf-H2C2_2 250..272 CDD:290200 8/25 (32%)
C2H2 Zn finger 265..285 CDD:275368 9/19 (47%)
zf-H2C2_2 277..300 CDD:290200 12/22 (55%)
zf-C2H2_8 292..370 CDD:292531 27/77 (35%)
C2H2 Zn finger 293..313 CDD:275368 4/19 (21%)
zf-H2C2_2 305..328 CDD:290200 6/22 (27%)
C2H2 Zn finger 321..341 CDD:275368 9/19 (47%)
zf-H2C2_2 333..356 CDD:290200 11/22 (50%)
C2H2 Zn finger 349..369 CDD:275368 7/19 (37%)
zf-H2C2_2 361..384 CDD:290200 10/22 (45%)
zf-C2H2 375..397 CDD:278523 9/35 (26%)
C2H2 Zn finger 377..397 CDD:275368 8/33 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.