DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44098 and CG31106

DIOPT Version :9

Sequence 1:NP_001262264.1 Gene:CG44098 / 40590 FlyBaseID:FBgn0264907 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_733086.2 Gene:CG31106 / 318594 FlyBaseID:FBgn0051106 Length:513 Species:Drosophila melanogaster


Alignment Length:468 Identity:83/468 - (17%)
Similarity:148/468 - (31%) Gaps:152/468 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 YHSVVTQYDL-VCSRD-ILVSVTQFFHLFGVLTGGILANQLLKYFSPRNVMLFGMITQIFCGNLT 400
            |.::|:|.|. :.|.| .::|...|   .|:.........|......|.|:::..|...|....:
  Fly    62 YITIVSQCDFEMNSMDKAVMSAASF---IGIFCSSYFWGYLSDTIGRRPVLIYTTIAGNFLSLCS 123

  Fly   401 GHVASYELHVFFR----CLSAVCCAQMYTAGGQIMADITGGKYRTCVSTLFEQFWSIGVMMLPGV 461
            ..:.:|.|:||.|    ...|...:..|...|:....    ::|.........|..:..:.:|..
  Fly   124 TVIPNYWLYVFIRFGVGFFIAGASSTTYAYLGEFFTP----RHRPIAINYASLFVGVSTVYVPAT 184

  Fly   462 ASF-----WS----------SWSHLYMAISWPTVI-LIYLWQWIPDSPRWLIARGRTQDAKKILL 510
            |..     ||          .|..|.:....|.|: .:.||. :|:||:.|::..:|::| ...:
  Fly   185 AWLILSMDWSVSITDGFSLRPWRLLTICYLLPGVVGTLMLWS-LPESPKILMSLHKTEEA-FAAV 247

  Fly   511 ECVEVNGTGYNLPHDIDQQLELQAQTAMDAPPPSGWWSMWKGERAVRHIVCVHLAWSLYIVVYYG 575
            :.:.|..:|.:| |:....   :.:|..:|          .||..                    
  Fly   248 DWIAVTNSGKHL-HEFKVH---KLKTEDNA----------NGENI-------------------- 278

  Fly   576 MLLNIRSFSRDHLYINTFFAGFSEMMGTFFGLFLILKTTRKWLW---------TGLFNIVAGCIA 631
            :|::..:|                             ||.|.:|         ..|.|.|..|..
  Fly   279 LLISKSAF-----------------------------TTIKKMWKETLPLLRRPHLLNFVISCTI 314

  Fly   632 YCGWLVPKPSVIGL-DPNVALLMCSAMVSKMAISTTLSILTTCTVELVSDDKKKITSFSTIC--- 692
            .|| |....|.:|| .|.:.        :::..:.....:|.|.|...|.|:.:..:.:.||   
  Fly   315 MCG-LFFSSSGMGLWYPEIQ--------NRLGSNAADDSMTVCQVIDASIDQMQANASNKICDDH 370

  Fly   693 -----WARFWLLGAPFIGSTVVFGQLIPQ-------------------------------TAFAS 721
                 :......|:..|...::.|.:|..                               ..|..
  Fly   371 INTKSYIDTITYGSALIVGYILMGLVINTIGRKASISIGLTLAGACAIALIFIKDEVAIVVCFCL 435

  Fly   722 LAILGGLCTSLIS 734
            ..:|.|||.|::|
  Fly   436 YLVLPGLCVSILS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44098NP_001262264.1 2A0119 214..730 CDD:273328 80/462 (17%)
MFS 353..733 CDD:119392 76/448 (17%)
CG31106NP_733086.2 2A0115 37..486 CDD:273327 83/468 (18%)
MFS 40..512 CDD:119392 83/468 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.