DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44098 and T05A1.5

DIOPT Version :9

Sequence 1:NP_001262264.1 Gene:CG44098 / 40590 FlyBaseID:FBgn0264907 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:232 Identity:56/232 - (24%)
Similarity:104/232 - (44%) Gaps:51/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 PCTEFQHESDYHSVVT-QYDLVCSRDIL----VSVTQFFHLFGVLTGGILANQLLKYFSPRNVML 387
            |||     .|..|.|| |.:...::.::    ::.:.||     |..||| .|:....:.|....
 Worm   112 PCT-----LDNCSFVTVQNEFNITKTLIDPGEMTSSIFF-----LGNGIL-GQIYAVAADRIGRR 165

  Fly   388 FGMITQIFCGNLTGHVASY----ELHV---FFR--CLSA-------VCCAQMYTAGGQIMADITG 436
            ..:|..:|...|:|..|:|    |:.:   ||:  |.:|       :||..:         ..:|
 Worm   166 PVLIASLFISGLSGIGAAYAPTFEIMLIGRFFQGSCFTALTMINWVMCCESI---------SFSG 221

  Fly   437 GKYRTCVSTLFEQFWSIGVMMLPGVASFWSSWSHLYMAISWPTVIL-IYLWQWIPDSPRWLIARG 500
            ..|   .|.||...|.||...:..:|.::|:|.::.:|.|.|.|:. |.:...:|:|..:|:|:.
 Worm   222 HGY---ASVLFGLCWVIGYCSVSPLAMYFSTWRYVQLATSVPCVLFGILMMFTLPESFSFLVAKR 283

  Fly   501 RTQDAKKILLECVEVNGTGYN--LPHDIDQQLELQAQ 535
            :..|    |::.:|:.....|  :.:|.||.:::.::
 Worm   284 KRDD----LVKWIEMASRVGNEEIDYDADQIVDMSSR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44098NP_001262264.1 2A0119 214..730 CDD:273328 56/232 (24%)
MFS 353..733 CDD:119392 48/206 (23%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 41/171 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162987
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.