DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAM and sns

DIOPT Version :10

Sequence 1:NP_005572.2 Gene:BCAM / 4059 HGNCID:6722 Length:628 Species:Homo sapiens
Sequence 2:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster


Alignment Length:665 Identity:149/665 - (22%)
Similarity:229/665 - (34%) Gaps:214/665 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    17 LLLAVLLAAHP---DAQAEVRLSVPPLVEVMRGKSVILDCTPTG-------THDHYMLEWFLTDR 71
            ||..::||:.|   .||.:...:.|..::|:.|...::.|....       |.|.:.|.:     
  Fly    54 LLAVIVLASAPVPSHAQQQKFRTTPHDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGF----- 113

Human    72 SGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQG--RLVLAEAQVGDERDYVCVVRAGAAGT 134
                    ||.:.|......:.|.:          ||  .|.::.|.:.|:.||.|.|......:
  Fly   114 --------SAVIPGFPRYSVLGDRK----------QGIYNLRISNASINDDADYQCQVGPARLNS 160

Human   135 A-EATARLNVFAKPEATEVS--PNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPV 196
            | .|.|:|.|.:.|.:.|:.  .:...:.|.|:...:: .|...|..||.:|.|||..      |
  Fly   161 AIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQL-KCIVANAKPAAQIVWYRGN------V 218

Human   197 EMNPEGYMTSRTVREASG-LLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRL--DSP---T 255
            |..||  ....||.|::. ..:.||:|.|:...||....:.|.|       ||..|  |.|   |
  Fly   219 EYKPE--KREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQA-------RHKALSPDMPMRAT 274

Human   256 FHLTLHYPTEHVQFWVGSPSTP------AG-WVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEV 313
            ..|::.||          |..|      || .:|.|.||:|:||..|...|...::.....|..:
  Fly   275 VQLSVLYP----------PGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQIRM 329

Human   314 -------LNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLEL-----RVAYLDPLEL 366
                   |:.|:   .|...........:.|...:..:.:.::....|.:     .|..:.|.|.
  Fly   330 AYRTSGRLSENI---YTFTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEA 391

Human   367 SEGKVLSL-----PLNSSAVVNCSVHG----------LPTPALRWTKDST--------------- 401
            ..|.::.|     |.|..|.:...|.|          :.:|...||..|.               
  Fly   392 RVGDIVPLTCTTAPSNPPAEIKWMVGGRQVRNATSKTIVSPEGGWTTTSNITAVVEPNKRSLVVI 456

Human   402 --------------------------PL-----------------------GDGPMLSL------ 411
                                      ||                       |..|:.:|      
  Fly   457 CHGLNMQLTENVVSTHTINVLYPPAPPLISGYMEGQIIPAGSVQKLLCVSSGGNPLATLTWYKND 521

Human   412 ---------------SSITF-----DSNGTYVCEA--SLPTVPVLSRTQNFTLLVQGSPELKTAE 454
                           :.||.     |:...|.|||  |...:|:.   |:.||.|..:||.....
  Fly   522 KRINSVIRAADKSVSAEITILANVSDNQAQYRCEASNSATEIPLF---QSTTLSVHFAPETVKIR 583

Human   455 IEPKADGSWREGDEVTLIC-SARGHPDPKLSWSQLGGSPAEPI-----PGRQGWVSSSLTLK--V 511
            |||:   ..|.|.|.|:|| |:..:|..||||.: .|.|.|.|     ||..|...|:|..:  |
  Fly   584 IEPE---ELRPGMEATIICDSSSSNPPAKLSWWK-DGIPIEGINNTSKPGLWGGTVSTLEFRVNV 644

Human   512 TSALSRDGISCEASN 526
            |..::....:|:::|
  Fly   645 TQEMNGQVYTCQSAN 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCAMNP_005572.2 V-set 37..143 CDD:462230 24/115 (21%)
C2-set_2 151..248 CDD:400489 26/99 (26%)
Ig strand C 182..186 CDD:409416 1/3 (33%)
IG_like 280..358 CDD:214653 15/89 (17%)
Ig strand B 287..291 CDD:409353 2/3 (67%)
Ig strand C 300..304 CDD:409353 0/3 (0%)
Interaction with laminin alpha5 309..312 1/2 (50%)
Ig strand E 320..324 CDD:409353 0/3 (0%)
Ig strand F 334..339 CDD:409353 1/4 (25%)
Ig_2 363..437 CDD:464026 27/180 (15%)
Ig_3 464..526 CDD:464046 24/69 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..628
snsNP_001036532.1 Ig 73..170 CDD:472250 24/119 (20%)
Ig strand B 89..93 CDD:409559 0/3 (0%)
Ig strand C 101..105 CDD:409559 0/3 (0%)
Ig strand E 130..138 CDD:409559 3/17 (18%)
Ig strand F 148..153 CDD:409559 3/4 (75%)
Ig 173..279 CDD:472250 34/121 (28%)
Ig strand B 196..200 CDD:409418 0/4 (0%)
Ig strand C 210..214 CDD:409418 1/3 (33%)
Ig strand E 241..245 CDD:409418 2/3 (67%)
Ig strand F 255..260 CDD:409418 1/4 (25%)
Ig strand G 272..275 CDD:409418 0/2 (0%)
Ig_3 285..361 CDD:464046 17/78 (22%)
Ig 377..>457 CDD:472250 14/79 (18%)
Ig strand B 397..401 CDD:409418 1/3 (33%)
Ig strand C 411..415 CDD:409418 0/3 (0%)
Ig strand E 440..444 CDD:409418 1/3 (33%)
Ig 477..560 CDD:472250 12/82 (15%)
Ig strand B 499..504 CDD:409418 0/4 (0%)
Ig strand C 514..518 CDD:409418 1/3 (33%)
Ig strand E 537..541 CDD:409418 1/3 (33%)
Ig strand F 551..556 CDD:409418 2/4 (50%)
Ig 584..666 CDD:472250 28/80 (35%)
Ig strand B 595..599 CDD:409416 1/3 (33%)
Ig strand C 609..613 CDD:409416 3/3 (100%)
Ig strand E 636..642 CDD:409416 2/5 (40%)
Ig strand F 652..657 CDD:409416 1/4 (25%)
Ig strand G 667..670 CDD:409416
Ig 678..767 CDD:472250
Ig strand B 696..700 CDD:409353
Ig strand C 710..714 CDD:409353
Ig strand E 733..737 CDD:409353
Ig strand F 747..752 CDD:409353
Ig_3 772..847 CDD:464046
Ig 881..963 CDD:472250
Ig strand B 885..888 CDD:409353
Ig strand C 897..901 CDD:409353
Ig strand E 929..933 CDD:409353
Ig strand F 943..948 CDD:409353
FN3 967..1051 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.