DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAM and beat-IIa

DIOPT Version :9

Sequence 1:NP_005572.2 Gene:BCAM / 4059 HGNCID:6722 Length:628 Species:Homo sapiens
Sequence 2:NP_001287375.1 Gene:beat-IIa / 42086 FlyBaseID:FBgn0038498 Length:431 Species:Drosophila melanogaster


Alignment Length:392 Identity:80/392 - (20%)
Similarity:130/392 - (33%) Gaps:114/392 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   277 PAGWVREGDTVQLLCRGDGSPSPEYT--LFRLQDE-----QEEVLNVNL-----------EGNLT 323
            ||  ||.|..|.|.|..|...:|.|:  .:|.|.|     ..|..|..:           ..|.|
  Fly    78 PA--VRRGQHVVLRCMYDLDGAPLYSAKFYRGQLEFYRYTPGEFPNTKVFPFPGIHVDVSSSNAT 140

Human   324 ---LEGVTRGQSGTYGCRV-------EDYDAADDVQLSKTLELR-VAYLDPLELSEGKVLSLPLN 377
               |..|..|.||.:.|.|       ....|.|.:|:.:..|.| ..:.:......|.||.    
  Fly   141 QVLLRNVGFGLSGNFSCEVTADAPLFSTATAVDTMQVVELPEKRPQVFTEHTRYEPGDVLR---- 201

Human   378 SSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNG---TYVCEASLPTVPVLSRTQ- 438
                .||               |||    |....:.:||..|.   |:|....:.|:..|..|: 
  Fly   202 ----ANC---------------STP----PSRPRAELTFTINNMVITHVDTEYIRTIDNLIATRI 243

Human   439 NFTLLVQGSPELKTAEIEPK-------ADGSWREGDEV----------TLICSAR-GHPDPKLSW 485
            :..:.:||   :..:.:.|.       .:..:..|..|          .|.|||: |....:...
  Fly   244 SLKMQLQG---IHFSSVNPAIYNNVYGLNSVYGHGGPVYAPNSNPGGLLLRCSAQIGDLYQEYKE 305

Human   486 SQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVA 550
            .:||....:|:|.|       :||...::|..                 |.....|...|.|...
  Fly   306 IELGTPQKDPVPAR-------VTLSSDTSLKN-----------------FFSSYFSTSASAASRL 346

Human   551 VMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPG--LSHSGS-EQPEQTGLLMGG 612
            :..|.::..::.::.::|..:.....||....::    |..:.|  :.||.. .:|::...|:..
  Fly   347 LPGVYMAPLIMAMLASLFRLIEAAFEPCDASSQD----PQSQTGHSMEHSKERREPKERPALVSS 407

Human   613 AS 614
            .|
  Fly   408 CS 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCAMNP_005572.2 Ig 37..143 CDD:325142
C2-set_2 151..248 CDD:311910
IG_like 280..358 CDD:214653 28/106 (26%)
Interaction with laminin alpha5 309..312 1/7 (14%)
IGc2 377..427 CDD:197706 11/52 (21%)
Ig_3 464..526 CDD:316449 15/72 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..628 7/39 (18%)
beat-IIaNP_001287375.1 PTZ00491 <209..>261 CDD:240439 11/54 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.