DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAM and beat-Va

DIOPT Version :9

Sequence 1:NP_005572.2 Gene:BCAM / 4059 HGNCID:6722 Length:628 Species:Homo sapiens
Sequence 2:NP_001189214.1 Gene:beat-Va / 41578 FlyBaseID:FBgn0038087 Length:300 Species:Drosophila melanogaster


Alignment Length:275 Identity:56/275 - (20%)
Similarity:89/275 - (32%) Gaps:100/275 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    16 LLLLAVLLAAHPDAQA--EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRL 78
            :.|...||..:|.|.|  ...:|||.:|:..  .:|.|.|                         
  Fly     7 MFLFIALLIDYPIAYALFVTDISVPEIVDFR--DNVTLSC------------------------- 44

Human    79 ASAEMQGSELQVTM----HDTRGR-----SPPYQ-LDSQGRLVLAEAQVGDERDYVC-------- 125
             |.:|:|..|....    |:...|     ||.|. .|..|..||       |..|||        
  Fly    45 -SYDMRGHTLNSVKWYKDHEEFFRYSPLTSPIYMTFDVAGLQVL-------EGKYVCNESSCRLD 101

Human   126 VVRAGAAGT----------------AEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNS 174
            :...||..|                |:....:.|.|.|:...:..:..::..||:..:  |||.|
  Fly   102 LSLQGAKSTGLYKCEVSGDAPHFKLADKADNMTVAALPQNDPLIESFNSMYRMEEYLK--ATCIS 164

Human   175 RNGNPAPKITWYRNG-------------------------QRLEVPVEMNPEGYMTSRTVREASG 214
            ...:...::|||.||                         |||:|...:..:.:..:..:.|...
  Fly   165 DFSSLPTRLTWYINGEQPLLGELYPTTDTSLAAHDYVLRRQRLQVQFFLQGQRFFQAGKILELKC 229

Human   215 LLSLTSTLYLRLRKD 229
            :..:.:  |..||::
  Fly   230 VAEIEN--YPELRRE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCAMNP_005572.2 Ig 37..143 CDD:325142 27/139 (19%)
C2-set_2 151..248 CDD:311910 19/104 (18%)
IG_like 280..358 CDD:214653
Interaction with laminin alpha5 309..312
IGc2 377..427 CDD:197706
Ig_3 464..526 CDD:316449
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..628
beat-VaNP_001189214.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.