DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAM and beat-IIIc

DIOPT Version :9

Sequence 1:NP_005572.2 Gene:BCAM / 4059 HGNCID:6722 Length:628 Species:Homo sapiens
Sequence 2:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster


Alignment Length:200 Identity:49/200 - (24%)
Similarity:81/200 - (40%) Gaps:55/200 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   355 ELRVAYLDPLELSEGKVLSLPL----NSSAVVNC--SVHGLPTPALRWTKDSTPL-----GDGP- 407
            :.|||   .|.|:|   :.:|:    .::|.:.|  .:.|....:::|.||....     .|.| 
  Fly    19 DFRVA---GLRLTE---VRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNEFYRYVPRDMPP 77

Human   408 -------------------MLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTA 453
                               :::|.::...|.|.:.||.|.......:.|::..::|...|:    
  Fly    78 AQTFLLPGVNVDLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPD---- 138

Human   454 EIEPKADGS---WREGDEVTLICSA-RGHPDPKLSWSQLGGSPAEP---------IPGRQGWVSS 505
            |..||..|.   ::.||.|.:.|:| |..|..|||| |:.|.|.|.         :.||.|..:|
  Fly   139 EGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSW-QVNGEPVEQQKLRKYDTIVSGRDGLETS 202

Human   506 SLTLK 510
            .|.|:
  Fly   203 VLGLQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCAMNP_005572.2 Ig 37..143 CDD:325142
C2-set_2 151..248 CDD:311910
IG_like 280..358 CDD:214653 0/2 (0%)
Interaction with laminin alpha5 309..312
IGc2 377..427 CDD:197706 13/76 (17%)
Ig_3 464..526 CDD:316449 21/56 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..628
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 15/93 (16%)
Ig 42..127 CDD:143165 14/84 (17%)
Ig 140..219 CDD:299845 24/68 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.