DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAM and ed

DIOPT Version :9

Sequence 1:NP_005572.2 Gene:BCAM / 4059 HGNCID:6722 Length:628 Species:Homo sapiens
Sequence 2:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster


Alignment Length:572 Identity:143/572 - (25%)
Similarity:214/572 - (37%) Gaps:130/572 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    31 AEVRLSVPPL----VEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARP----RLASAEMQGSE 87
            |.|.||...|    ::......:.|.|.....::.....:|.| |..|.|    .:|..|:|   
  Fly    32 ALVALSSTTLADESIDTRENADLTLKCRFNDKYEANDFSFFWT-RWTANPAQFDNVAIGEVQ--- 92

Human    88 LQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGD---ERD---YVCVVRAGAAG--TAEATARLNVF 144
                      .|..|:||.|....:.:.|:.:   .||   :.|.::|...|  ..:....|.|.
  Fly    93 ----------LSSGYRLDFQPERGIYDLQIKNVSYNRDNGRFECRIKAKGTGADVHQEFHNLTVL 147

Human   145 AKPEATEVSPNKGTLSV-MEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRT 208
            ..|....:||  |.::| .||...|: ||:|..|:|.|.|||||.|....:|..:...|.....|
  Fly   148 TPPHPPVISP--GNIAVATEDKPMEL-TCSSIGGSPDPTITWYREGSNTPLPATVLKGGTKDQPT 209

Human   209 VREASGLLSLTSTLYLRLRKDDRDASFHCAA-HYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVG 272
                      .:||.:..|::|..|.:.|.. :.::.||:  ||::.......:||...|     
  Fly   210 ----------NATLSIIPRREDDGAKYKCVVRNRAMNEGK--RLEATATLNVNYYPRVEV----- 257

Human   273 SPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNV--NLEGNL-------TLEGVT 328
            .|..|.. |....|.:|.|..|..|              :|.||  |..|..       |:..|:
  Fly   258 GPENPLR-VERDRTAKLECNVDAKP--------------KVPNVRWNRNGRFISSSLVHTIHRVS 307

Human   329 RGQSGTYGCRVEDYDAADDVQLSKT----LELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGL 389
            ...:|.|.|      .||: .|.||    |.|.:.| .|:.:.|.|........:..:.|:|...
  Fly   308 VQDAGKYTC------IADN-GLGKTGEQELILDILY-PPMVVIESKTREAEEGDTVTIRCNVTAN 364

Human   390 PTP-ALRWTKDSTP--LGDGPMLSLSSITFDSNGTYVCEASLPTVPVL--------SRTQNFT-- 441
            |.| .:.|.|:::|  ..:|.:|:|:|:..|..|.|:|.|    |.::        .|..|.|  
  Fly   365 PAPVTIEWLKENSPDFRYNGDVLTLTSVRADHAGNYICRA----VNIMQSQGMERSERVGNSTVA 425

Human   442 LLVQGSPELKTAEIEPKADGSWREGDEVTLICSAR--GHPDPKLSWSQLGGSPAEPIPGRQGWVS 504
            |||:..|  ..|.|.|... ....|:.|||.|||.  |.|.|:..|.:          ...|..|
  Fly   426 LLVRHRP--GQAYITPNKP-VVHVGNGVTLTCSANPPGWPVPQYRWFR----------DMDGEFS 477

Human   505 SSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAV 556
            |      |..:...|........|......:|...|    ::.|:.:||..|
  Fly   478 S------TQKILAQGPQYSIPKAHLGNEGKYHCHAV----NELGIGMMATIV 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCAMNP_005572.2 Ig 37..143 CDD:325142 23/121 (19%)
C2-set_2 151..248 CDD:311910 30/98 (31%)
IG_like 280..358 CDD:214653 23/90 (26%)
Interaction with laminin alpha5 309..312 0/2 (0%)
IGc2 377..427 CDD:197706 15/52 (29%)
Ig_3 464..526 CDD:316449 16/63 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..628
edNP_001260013.1 Ig 50..147 CDD:299845 22/110 (20%)
I-set 146..249 CDD:254352 34/117 (29%)
Ig 168..249 CDD:299845 26/93 (28%)
IGc2 268..323 CDD:197706 17/75 (23%)
Ig_3 341..406 CDD:290638 18/68 (26%)
Ig_2 437..514 CDD:290606 22/97 (23%)
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.