DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and RPN11

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_116659.1 Gene:RPN11 / 850554 SGDID:S000001900 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:34/145 - (23%)
Similarity:58/145 - (40%) Gaps:21/145 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVRVHPVVLFQVVDAFERRNADSHRVIGTLLGS-VDKGVVEVTNCFCVPHKEHDDQVEA-ELSYA 69
            ||.:..:.|.:::.  ..|......|:|.:||. ||...|.|.:.|.:|.......||| :..:.
Yeast    26 TVYISSIALLKMLK--HGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQ 88

  Fly    70 LDMYDLNRKVNSNESVVGW---------WATGNDVTNHSSVIHEYYARECNNPVHLTVDTSLQG- 124
            ..|.|:.::...::.||||         |.:..||....|.      .:.|:.....|...:|. 
Yeast    89 AKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSF------EQLNSRAVAVVVDPIQSV 147

  Fly   125 -GRMGLRAYVCIQLG 138
             |::.:.|:..|..|
Yeast   148 KGKVVIDAFRLIDTG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 33/144 (23%)
RPN11NP_116659.1 MPN_RPN11_CSN5 22..282 CDD:163700 34/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.