DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and MPND

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001287791.1 Gene:MPND / 84954 HGNCID:25934 Length:501 Species:Homo sapiens


Alignment Length:239 Identity:54/239 - (22%)
Similarity:88/239 - (36%) Gaps:72/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVLFQVVDAFERRNA----------DSH------RVIGTLLG--SVDKGVVEVTNCFCVPHKEHD 59
            |..|..::.|:..|.          |.|      .|:|.|.|  .|:..::.|...|....:..|
Human   258 VTSFAAINKFQPFNVAVSSNVLFLLDFHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGD 322

  Fly    60 DQ----VEAELSYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYARECNNPVHLTVDT 120
            .:    :|.|:..:|.:..|        |:|||:        ||            :| |.....
Human   323 AETAAAIEEEIYQSLFLRGL--------SLVGWY--------HS------------HP-HSPALP 358

  Fly   121 SLQGGRMGLRAYVCIQLGVPGGKSGCMFTPIPVELTS--YE----PETFGLKLLQKTVGVSPAHR 179
            |||    .:.|.:..||.:.|..:|  |.|....|.|  |.    ||:   |:....|...|..|
Human   359 SLQ----DIDAQMDYQLRLQGSSNG--FQPCLALLCSPYYSGNPGPES---KISPFWVMPPPEQR 414

  Fly   180 PKT--VPPMLDLAQISEASTKLQSLLDLILKYVDDVIAHKVTPD 221
            |..  :|..:::|.:.::......|.:::|.    |..:|.:||
Human   415 PSDYGIPMDVEMAYVQDSFLTNDILHEMMLL----VEFYKGSPD 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 54/239 (23%)
MPNDNP_001287791.1 MPN_2A_DUB 266..450 CDD:163698 49/225 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.