DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and stambpa

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_956792.1 Gene:stambpa / 797422 ZFINID:ZDB-GENE-040426-1551 Length:418 Species:Danio rerio


Alignment Length:198 Identity:44/198 - (22%)
Similarity:64/198 - (32%) Gaps:61/198 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ERRNADSHRVIGTLLGSVDKGVVEVTN------C----FCVPHKEHDDQVEAELSYALDMYDLNR 77
            |...|.:....|.|.|.:.|....||:      |    :|      |.:.|.||....|..||  
Zfish   266 ETNTARAVETCGILCGKLMKNAFTVTHVIVPKQCGGPDYC------DTENEEELFLIQDQNDL-- 322

  Fly    78 KVNSNESVVGWWATGNDVTNH-SSV-IHEYYARECNNPVHLTVDTSLQGGRMGLRAYVCIQLGVP 140
                  ..:||..|....|.. ||| :|.:.:.:...|..:.:..|.:....|.           
Zfish   323 ------ITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIVCSPKFNETGY----------- 370

  Fly   141 GGKSGCMFTPIPVELTSYEPETFGLKLLQKTVGVSPAHRPKTVPPMLDLA---QISEASTKLQSL 202
                        ..||.|..:..|   ..|..|..|  .||. ||:...:   .|::.|.   ::
Zfish   371 ------------FRLTDYGMDDVG---TCKQRGFHP--HPKD-PPLFAASHHVSITDGSV---TM 414

  Fly   203 LDL 205
            |||
Zfish   415 LDL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 44/198 (22%)
stambpaNP_956792.1 USP8_dimer 13..114 CDD:286108
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..218
MPN_AMSH_like 248..418 CDD:163697 44/198 (22%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 329..342 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.