Sequence 1: | NP_649489.1 | Gene: | eIF3f1 / 40587 | FlyBaseID: | FBgn0037270 | Length: | 280 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956792.1 | Gene: | stambpa / 797422 | ZFINID: | ZDB-GENE-040426-1551 | Length: | 418 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 44/198 - (22%) |
---|---|---|---|
Similarity: | 64/198 - (32%) | Gaps: | 61/198 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 ERRNADSHRVIGTLLGSVDKGVVEVTN------C----FCVPHKEHDDQVEAELSYALDMYDLNR 77
Fly 78 KVNSNESVVGWWATGNDVTNH-SSV-IHEYYARECNNPVHLTVDTSLQGGRMGLRAYVCIQLGVP 140
Fly 141 GGKSGCMFTPIPVELTSYEPETFGLKLLQKTVGVSPAHRPKTVPPMLDLA---QISEASTKLQSL 202
Fly 203 LDL 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
eIF3f1 | NP_649489.1 | MPN_eIF3f | 8..274 | CDD:163695 | 44/198 (22%) |
stambpa | NP_956792.1 | USP8_dimer | 13..114 | CDD:286108 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 199..218 | ||||
MPN_AMSH_like | 248..418 | CDD:163697 | 44/198 (22%) | ||
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 | 329..342 | 4/12 (33%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1310 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |