DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and Mpnd

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_080806.4 Gene:Mpnd / 68047 MGIID:1915297 Length:487 Species:Mus musculus


Alignment Length:245 Identity:53/245 - (21%)
Similarity:82/245 - (33%) Gaps:85/245 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVLFQVVDAFERRNA----------DSH------RVIGTLLG--SVDKGVVEVTNCFCVPHKEHD 59
            |..|..::.|:..|.          |.|      .|:|.|.|  .::..::.|...|....:..|
Mouse   244 VTSFAAINKFQPFNVAVSSNVLFLLDFHCHLTRSEVVGYLGGRWDINNQMLTVLRAFPCRSRLGD 308

  Fly    60 DQ----VEAELSYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVI---------HEYYARECN 111
            ..    ||.|:...|.:..|        |:|||:.:    ..||..:         .||..|   
Mouse   309 TDTAATVEEEIYQVLFLRGL--------SLVGWYHS----HPHSPAVPSLQDIDAQMEYQLR--- 358

  Fly   112 NPVHLTVDTSLQGGRMGLRAYVCIQL-------GVPGGKSG-CMF--------------TPIPVE 154
                      |||...|.:.  |:.|       |.||.:|. |.|              .|:.||
Mouse   359 ----------LQGSSNGFQP--CLALLCSPYYSGNPGPESKICPFWVMPPPEQRPSDYGIPMDVE 411

  Fly   155 LTSYEPETFGLKLLQKTVGVSPAHRPKTVPPMLDLAQISEASTKLQSLLD 204
            :...:.......:||:.|.::..:  |..|   ||.:..||.:...:.||
Mouse   412 MAYVQDSFLTNDVLQEMVMLAEFY--KGAP---DLVKFQEAWSPEHTYLD 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 53/245 (22%)
MpndNP_080806.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..217
MPN_2A_DUB 252..436 CDD:163698 43/212 (20%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 335..348 2/16 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.