DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and cops6

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001265456.1 Gene:cops6 / 448375 XenbaseID:XB-GENE-947827 Length:319 Species:Xenopus tropicalis


Alignment Length:271 Identity:59/271 - (21%)
Similarity:122/271 - (45%) Gaps:7/271 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLTVRVHPVVLFQVVDAFERRNADSHR---VIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAEL 66
            ::||.:||:|:..:.|.:.|..:...|   |||.|:|..:...:||.|.|.:..:.:::::....
 Frog    30 SVTVALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSQINEEKITINK 94

  Fly    67 SYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYARECNNPVHLTVDTSLQGGRMGLRA 131
            .|.....:..::|..:...:||:.||.........:|:.......:|:.|.::...:...:.:..
 Frog    95 EYYYTKEEQFKQVFKDMEFLGWYTTGGTPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSV 159

  Fly   132 YVCIQLGVPGGKSGCMFTPIPVELTSYEPETFGLKLLQKTVGVSPAHRPKTVPPMLDLAQISEAS 196
            |..: :.:..|::..:...:...|.:.|.|..|:..:.:......... .||...| :||.| |.
 Frog   160 YESV-IDIVNGEATMLLAELSYTLATEEAERIGVDHVARMTATGSGEN-STVAEHL-IAQHS-AI 220

  Fly   197 TKLQSLLDLILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVRNLLLVITLS 261
            ..|.|.:.|||:||....|.:|..::.:.|:...|.|.:|.::.::|...|.....::.|:..|.
 Frog   221 KMLHSRVRLILEYVRAAEAGEVPFNHEILREASALCHCLPVLSTDKFKMDFYDQCNDVGLMSYLG 285

  Fly   262 QLIKTQLQLNE 272
            .:.||...:|:
 Frog   286 TITKTCNTMNQ 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 58/268 (22%)
cops6NP_001265456.1 MPN_CSN6 31..313 CDD:163694 59/270 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.