DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and CSN6

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster


Alignment Length:271 Identity:62/271 - (22%)
Similarity:119/271 - (43%) Gaps:20/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLTVRVHPVVLFQVVD---AFERRNADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAEL 66
            ::|:.:||:|:..:.:   .|..::.:..:|.|.|:|......:|:.|.|.:......|:.....
  Fly    51 SVTISLHPLVIMNISEHWTRFRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDVIGDETVINK 115

  Fly    67 SYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYA--RECN-----NPVHLTVDTSLQG 124
            .|........::|.|:...:||:.||::.|.....|....|  .||.     ||:..:||     
  Fly   116 DYYNKKEQQYKQVFSDLDFIGWYTTGDNPTADDIKIQRQIAAINECPIMLQLNPLSRSVD----- 175

  Fly   125 GRMGLRAYVCIQLGVPGGKSGCMFTPIPVELTSYEPETFGLKLLQKTVGVSPAHRPKTVPPMLDL 189
             .:.|:.:..: :.:..|::..:|.|:...|.:.|.|..|:..:.:.  .|.....|:|.....:
  Fly   176 -HLPLKLFESL-IDLVDGEATMLFVPLTYTLATEEAERIGVDHVARM--TSNESGEKSVVAEHLV 236

  Fly   190 AQISEASTKLQSLLDLILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVRNL 254
            ||.| |...|.:.:.::|:|:.||.|.|:..:..:.|:...|.|.:|.|....|.:.|.....::
  Fly   237 AQDS-AIKMLNTRIKIVLQYIRDVEAGKLRANQEILREAYALCHRLPVMQVPAFQEEFYTQCNDV 300

  Fly   255 LLVITLSQLIK 265
            .|:..|..|.|
  Fly   301 GLISYLGTLTK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 61/268 (23%)
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 62/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449352
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10540
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.