DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and CG4751

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_609495.1 Gene:CG4751 / 34551 FlyBaseID:FBgn0032348 Length:1412 Species:Drosophila melanogaster


Alignment Length:254 Identity:50/254 - (19%)
Similarity:86/254 - (33%) Gaps:73/254 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GSVDKGVVEVTNCFCVPHKEHDDQVEAELSYALDMYDLNRKVNSNESVVGWWATGNDVTNH---- 98
            |:....::|...|        |..|::      |..|.:....:.|:..|:..||..||..    
  Fly    85 GAAPVAILEDNMC--------DKDVDS------DAGDEDNDDETKENYEGFNGTGRTVTLQTLMA 135

  Fly    99 SSVIH--------EYYARECNNPVHLTVDTSLQGGRM------------GLRAYVCIQLGVPGGK 143
            ::|:.        ||..::       .|...|..|::            ...|..|.::..|..|
  Fly   136 ANVLQPGLGLMTIEYLGQK-------FVGDLLADGKIKSHETETIFLTPSAWAMHCKRIINPDKK 193

  Fly   144 SGCMFTPIPV---ELTSYEPETFGLKLLQKTVGVSPAHRPKTVPPMLDLAQISEASTKLQSLLDL 205
            |||.:..:..   :|.:|:........|||..            |:.|....:|..|...   ::
  Fly   194 SGCGWASVKYKGKKLDAYKNTYLRKCALQKET------------PLDDCELDAERKTDTP---EI 243

  Fly   206 ILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVRNLLLVITLSQLI 264
            ::|..  |.||....:..|......||.|||      ||.:  ..::..|:.:..|.|:
  Fly   244 VVKRT--VFAHNTVSNRNVVHDANMLIESVP------FTSV--GKLQPFLITVNSSALL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 50/254 (20%)
CG4751NP_609495.1 MPN_2A_DUB 278..463 CDD:163698 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.